[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : phnH
DDBJ      :phnH         conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  120/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.67.2
:203 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->199 2fsuA PDBj 7e-15 34.1 %
:RPS:SCOP  19->199 2fsuA1  c.67.2.1 * 2e-04 28.7 %
:RPS:PFM   9->199 PF05845 * PhnH 3e-38 44.5 %
:HMM:PFM   10->199 PF05845 * PhnH 2.3e-70 45.8 190/192  
:BLT:SWISS 2->199 PHNH_RHIME 1e-51 46.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86000.1 GT:GENE phnH GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(183869..184480) GB:FROM 183869 GB:TO 184480 GB:DIRECTION - GB:GENE phnH GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86000.1 GB:DB_XREF GI:15155065 GB:GENE:GENE phnH LENGTH 203 SQ:AASEQ MMGVKAEALTGGFSSAVFDSQRIFKKLMDGMARPGTPQTIETAVAPPLPLAAATGAVLLALCDHDTPVWLNGALRKTAVPGWIGFHTGAPATEEKGAAHFAVIEAGSAIASFGLFAQGSQEYPDRSTTLIIELSDLDGGRELLLSGPGIRHVNIISPSGLPDIFPMLWAENNAIFPRGVDVILTAGDKFVCLPRTTRIKPVEA GT:EXON 1|1-203:0| BL:SWS:NREP 1 BL:SWS:REP 2->199|PHNH_RHIME|1e-51|46.0|198/200| SEG 42->61|tavapplplaaatgavllal| BL:PDB:NREP 1 BL:PDB:REP 19->199|2fsuA|7e-15|34.1|164/167| RP:PFM:NREP 1 RP:PFM:REP 9->199|PF05845|3e-38|44.5|191/192|PhnH| HM:PFM:NREP 1 HM:PFM:REP 10->199|PF05845|2.3e-70|45.8|190/192|PhnH| GO:PFM:NREP 1 GO:PFM GO:0015716|"GO:phosphonate transport"|PF05845|IPR008772| RP:SCP:NREP 1 RP:SCP:REP 19->199|2fsuA1|2e-04|28.7|167/170|c.67.2.1| OP:NHOMO 123 OP:NHOMOORG 120 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---11111----------1------1-1-3--11111111111111-----1----111---------------------------------------------------------------1111--1111111---11111---------1---111-------11-------------------11-------------------------------------------------11-------------------------------------------1111-1-1111111111-111111111111111111-11112----1--------------11-1---1--111111-11111---------------------------------------------1111---11-----111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 164 STR:RPRED 80.8 SQ:SECSTR ##################cHHHHHHHHHHH#HcTTccEEccccccccTTccHHHHHHHHHHccTTccEEEcGGGccHHHHHHHHHHHcccccccGGGccEEEEc##TTccHHHHHHTc#######ccEEEEEcccccccc#EEEEcc#####cEEccc#ccHHHHHHHHHcccTTTTccEEEEEETTEEEEEcTTcEEE#### DISOP:02AL 1-4, 199-203| PSIPRED cccccHHHHccccccHHHHHHHHHHHHHHHHccccccEEcccccccccHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHccccccccHHHccEEEEEccccccHHHccccccccccccccEEEEEEcccccccEEEEEccccccEEEEEEccccHHHHHHHHHHHccccccEEEEEEccccEEEcccccEEEEccc //