[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : phnI
DDBJ      :phnI         conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  140/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:369 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   64->170 3bjqI PDBj 7e-04 13.3 %
:RPS:PFM   1->355 PF05861 * PhnI e-139 69.7 %
:HMM:PFM   1->352 PF05861 * PhnI 7.9e-176 68.3 350/359  
:BLT:SWISS 1->369 PHNI_RHIME e-146 74.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85999.1 GT:GENE phnI GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(182758..183867) GB:FROM 182758 GB:TO 183867 GB:DIRECTION - GB:GENE phnI GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK85999.1 GB:DB_XREF GI:15155064 GB:GENE:GENE phnI LENGTH 369 SQ:AASEQ MYVAVKGGETAIANAHRLLADQRRGDRDLPAMTVAQIVSQLSLAVDRVMAEASLYDQSLAALAVKQARGDMIEAIFLLRAYRTTLPRFGYSVPVDTADMVVQRRVSATYKDLPGGQLLGPTFDYTHRLLDPSLLEDEGVETATQREGEPEYVVRVSDILAQEGLIESDGDMPDDHIAGDLTREPMEFPMPRDLRLQSLARGDEGFLLALAYSTQRGYGRTHPFVGEIRIGEVEVELDVPELGFSVSLGDIKVTECQMVNQFKGSAKAPPQFTRGYGLVFGQSERKAMAMSLVDRALRAGEFGEDVVAPAQDEEFVISHADNVQATGFVEHLKLPHYVDFQAELGLVRKMRADFEAINANGAEWMSDAAE GT:EXON 1|1-369:0| BL:SWS:NREP 1 BL:SWS:REP 1->369|PHNI_RHIME|e-146|74.7|368/368| SEG 224->235|vgeirigeveve| RP:PDB:NREP 1 RP:PDB:REP 64->170|3bjqI|7e-04|13.3|105/287| RP:PFM:NREP 1 RP:PFM:REP 1->355|PF05861|e-139|69.7|353/355|PhnI| HM:PFM:NREP 1 HM:PFM:REP 1->352|PF05861|7.9e-176|68.3|350/359|PhnI| GO:PFM:NREP 1 GO:PFM GO:0015716|"GO:phosphonate transport"|PF05861|IPR008773| OP:NHOMO 148 OP:NHOMOORG 141 OP:PATTERN ----------------------------1--------------------------------------- -------------------------------------------------1------------------------------1-------------------------------------------------------111-1---------11--1-------------1-1---------------------------------------------------1-----------------------------------------------------------------------------------------------------1--------------1-----------------------------------------------111---11111----------1---1--1-1-3--11111111111111-----1----111--------1------------------------------------------------------1111--1111111---11111------2--1---111---1---11-------------------11-------------------------------------------------11----4-----1--------------------------------1-11-1-1111111111-111111111111111111-11112----1--------------11-1---1--111111111111---------------------------------------------1111---11-----111---------1--------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 28.5 SQ:SECSTR ###############################################################HHTTccccHHHHHHHTcc##EEEEEccEEEccEEETTTTcEEEEcccccccccTTccccEEEEEETTccEEcccEEETTTTEEEEEEEccEEEEEccGGEEEEETTT####################################################################################################################################################################################################### DISOP:02AL 138-149, 353-369| PSIPRED cEEEEccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHccccccccccEEEEEEHHHHHcccccccccccHHHHHHHccHHHHcccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHcccccccccEEEEEEEEEEEEEEccccccccccccEEEEHHHHHHHHcccccccccEEEEcEEEEEccHHHHHHHHHHHHHHHHHHHHccccccccccHHEEEEEcccccHHHHHHHcccccEEcHHHHHHHHHHHHHHHHHHcccccccHHHHcc //