[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : phoB
DDBJ      :phoB         two component response regulator
Swiss-Prot:PHOB_RHIME   RecName: Full=Phosphate regulon transcriptional regulatory protein phoB;

Homologs  Archaea  23/68 : Bacteria  854/915 : Eukaryota  31/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:227 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->226 2oqrA PDBj 3e-45 43.8 %
:RPS:PDB   4->224 3c3wB PDBj 1e-29 25.2 %
:RPS:SCOP  4->122 1a0oA  c.23.1.1 * 8e-29 28.6 %
:RPS:SCOP  123->227 1ys6A1  a.4.6.1 * 1e-25 33.3 %
:HMM:SCOP  3->127 1k66A_ c.23.1.1 * 5.7e-36 46.4 %
:HMM:SCOP  123->228 1ys7A1 a.4.6.1 * 2.6e-30 46.2 %
:RPS:PFM   5->117 PF00072 * Response_reg 2e-16 46.4 %
:RPS:PFM   152->225 PF00486 * Trans_reg_C 2e-13 52.7 %
:HMM:PFM   5->117 PF00072 * Response_reg 1.7e-29 43.2 111/112  
:HMM:PFM   151->224 PF00486 * Trans_reg_C 2.2e-28 51.4 74/77  
:BLT:SWISS 1->227 PHOB_RHIME e-121 93.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86239.1 GT:GENE phoB GT:PRODUCT two component response regulator GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 422089..422772 GB:FROM 422089 GB:TO 422772 GB:DIRECTION + GB:GENE phoB GB:PRODUCT two component response regulator GB:PROTEIN_ID AAK86239.1 GB:DB_XREF GI:15155345 GB:GENE:GENE phoB LENGTH 227 SQ:AASEQ MVPKIAVVEDEEALSVLLRYNLEAEGYDVDTIPRGDEAEIRLQERIPDLLILDWMLPGVSGIELCRRLRMRPETERLPIIMLTARGEESERVRGLATGADDYVVKPFSTPELMARVKAMLRRARPEVLSSVLKCGDIELDRETHRVHRKSREVRLGPTEFRLLEFLMTSPGRVFSRSQLLDGVWGHDIYVDERTVDVHVGRLRKALNFSHMQDVIRTVRGAGYSMEA GT:EXON 1|1-227:0| SW:ID PHOB_RHIME SW:DE RecName: Full=Phosphate regulon transcriptional regulatory protein phoB; SW:GN Name=phoB; OrderedLocusNames=R00515; ORFNames=SMc02140; SW:KW Activator; Complete proteome; Cytoplasm; DNA-binding;Phosphate transport; Phosphoprotein; Transcription;Transcription regulation; Transport; Two-component regulatory system. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->227|PHOB_RHIME|e-121|93.0|227/227| GO:SWS:NREP 7 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006817|"GO:phosphate transport"|Phosphate transport| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| GO:SWS GO:0006810|"GO:transport"|Transport| GO:SWS GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|Two-component regulatory system| BL:PDB:NREP 1 BL:PDB:REP 5->226|2oqrA|3e-45|43.8|219/226| RP:PDB:NREP 1 RP:PDB:REP 4->224|3c3wB|1e-29|25.2|206/210| RP:PFM:NREP 2 RP:PFM:REP 5->117|PF00072|2e-16|46.4|110/111|Response_reg| RP:PFM:REP 152->225|PF00486|2e-13|52.7|74/77|Trans_reg_C| HM:PFM:NREP 2 HM:PFM:REP 5->117|PF00072|1.7e-29|43.2|111/112|Response_reg| HM:PFM:REP 151->224|PF00486|2.2e-28|51.4|74/77|Trans_reg_C| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00486|IPR001867| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00486|IPR001867| GO:PFM GO:0003677|"GO:DNA binding"|PF00486|IPR001867| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00486|IPR001867| RP:SCP:NREP 2 RP:SCP:REP 4->122|1a0oA|8e-29|28.6|119/128|c.23.1.1| RP:SCP:REP 123->227|1ys6A1|1e-25|33.3|105/106|a.4.6.1| HM:SCP:REP 3->127|1k66A_|5.7e-36|46.4|125/149|c.23.1.1|1/1|CheY-like| HM:SCP:REP 123->228|1ys7A1|2.6e-30|46.2|106/0|a.4.6.1|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 14205 OP:NHOMOORG 908 OP:PATTERN -----------------------2-----21---31--11111E7-5J3C749-1-1-11-------- CVR7W466778655CCCBB-BH44CCBBBBBAHEGFAHIFEIILFB689BB9EGH55811LIO6V7IUPRB444465559JB715787JJgV-I22---86M4EDc6XES--------1-----232353438384dffefKAGk7*dsraYFQTIJ978BB9XcNJ***Q695665685655IGCAA453C9IXXYXYWXYIYVZaXUILGEDFXYgAADZ8HGA99A9Alb7AA9A99899AAA9979996B675CC655466677CC655675686DED866899988888898888555556666865597766476777WKNgRRRWVVWTTMFeWWADFBRKL8BGGNE5hdTIDA57789798428SPENLLL88888KHaUXHCHMRKOSCCBCCCCCBBF-PRbOTWUXGRC3VQQNQOOXYONONOCCIHCIOIOLFGDEEEEEEEEEFECBZKF3332222222334344343333323222239HI88EHGDJZYcahXYOOOJUUdhQOQPFQfaaWcae23OTTiKTJJiSSVXALTPIJEHTC1211111A8ALa*GcfIBBbL9faHGQ2oeofYbgMNVUZTxrITJ9886777777444544444GO9CN88UMBLTTR9KIHRHNNKJLNSPPKRROPMUV--6CDEH------HHFHGGBFGGGFGGHFF-GHGFFFFFFHGFFFFFFFEKJKDG99AFEFFFFFFEFFEFEFFIEDEEEFF81DGGGGGGGGGGG--2F333336556CKuEX444333244443125FEDEG9EABCOPdZgddmnmWjlpjVdag321213212AIKKRIJJJJPOSQRWYRNRNONOPAA9A--n3FG99AA222-21--3-2-------------------------5C446676565V3 ----11--------4------------------------------------------------------1----1------111----------2-222-32-114--2-------------------------------------------------3----2-1-------4-136-----1-5--D---22C---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 227 STR:RPRED 100.0 SQ:SECSTR EEEEEEEEcccHHHHHHHHHHHHTcTTEEEEEccHHHHHHHHHHHcccEEEEccEETTEEHHHHHHHHHHHcTccTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHGGHHGccHTTHHHHHHHHHHHHHHHHccTTTTccHHHHHHHHHHTTTccHHHcccHHHHHHHHHHHTccHHHHHHHHHHHHHHTTcccccHHHHHHHHHTccEcc DISOP:02AL 122-131| PSIPRED ccccEEEEEccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccccccEEEEccEEEEcccEEEEEccEEEEccHHHHHHHHHHHHcccccccHHHHHHHHccccccccccEEHHHHHHHHHHHcccccccEEEEEEccEEEEEc //