[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : pncA
DDBJ      :pncA         pyrazinamidase/nicotinamidase
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  358/915 : Eukaryota  116/199 : Viruses  0/175   --->[See Alignment]
c.33.1
:208 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->201 1im5A PDBj 5e-30 44.8 %
:RPS:PDB   1->206 2a67B PDBj 2e-26 22.6 %
:RPS:SCOP  3->206 1nf8A  c.33.1.3 * 6e-32 20.1 %
:HMM:SCOP  1->207 1nbaA_ c.33.1.3 * 1.1e-41 36.6 %
:RPS:PFM   3->201 PF00857 * Isochorismatase 8e-35 48.2 %
:HMM:PFM   3->203 PF00857 * Isochorismatase 3.1e-30 30.0 170/174  
:BLT:SWISS 2->204 PNCA_ECOLI 4e-52 52.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87817.2 GT:GENE pncA GT:PRODUCT pyrazinamidase/nicotinamidase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2028591..2029217 GB:FROM 2028591 GB:TO 2029217 GB:DIRECTION + GB:GENE pncA GB:PRODUCT pyrazinamidase/nicotinamidase GB:PROTEIN_ID AAK87817.2 GB:DB_XREF GI:159140309 GB:GENE:GENE pncA LENGTH 208 SQ:AASEQ MKALLLIDIQNGFCPGGNLAVTDGDAVVPIANALIDNGGYDLIVASQDWHPENHGSFASQHPGKQPFDMGELSGKPQMMWPDHCVQGTPDAEFHPDLNMEAFDYIQQKGENPAIDSYSAFRDNDQVATTGLSDYLARQGVTQLDVCGLATDYCVSFSVQDALDMLPGVKVRFIEDASRGIDPQGIKAAVAAMREKGAVILKSRDILRN GT:EXON 1|1-208:0| BL:SWS:NREP 1 BL:SWS:REP 2->204|PNCA_ECOLI|4e-52|52.0|200/213| BL:PDB:NREP 1 BL:PDB:REP 2->201|1im5A|5e-30|44.8|172/179| RP:PDB:NREP 1 RP:PDB:REP 1->206|2a67B|2e-26|22.6|159/164| RP:PFM:NREP 1 RP:PFM:REP 3->201|PF00857|8e-35|48.2|168/173|Isochorismatase| HM:PFM:NREP 1 HM:PFM:REP 3->203|PF00857|3.1e-30|30.0|170/174|Isochorismatase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00857|IPR000868| GO:PFM GO:0008152|"GO:metabolic process"|PF00857|IPR000868| RP:SCP:NREP 1 RP:SCP:REP 3->206|1nf8A|6e-32|20.1|174/207|c.33.1.3| HM:SCP:REP 1->207|1nbaA_|1.1e-41|36.6|183/253|c.33.1.3|1/1|Isochorismatase-like hydrolases| OP:NHOMO 513 OP:NHOMOORG 486 OP:PATTERN -----------------------1-11---1-----------------------1111111---1--- 1---11-111111111111-11--111111111111111111111111111-1111-11111111121131----111-1---1-111-----------11--1----1--------------------------------------------------------------------------------------------------------------------111111-------------------------------------------------------------------------------------------------1111111-1----------1----------------------1--------1111111-212--------11111111111-1111111111--11111111111111---1111111111111111111111--11----------------------------------------1111111111111-111111111-1111--111--------111-------1-1111111--1-----1------------111-1111-1111-------------------------------11-----1--1----------------------1111------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111-----111111111--1----------------1111111---1-11111-1-1---1-111-------------11111111--111--------1111--11-------111--1--------1---1--------2---------1-1-1-1--2- ----111-2121--111111111111111111111111-1111-1-111111-1111-111111111111111111111111111111-12-112111112--111--113------------------------------------------------1122121-1112131-1-11711-1-----1----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 205 STR:RPRED 98.6 SQ:SECSTR cEEEEEEcccGGGccccccccTTHHHHHHHHHHHHHHHTTccEEEEEHHHHTTccEEEEEETTccTTEETcccTcTTHHccTTccTTcTTTcccTTccccTTcEEEEEccccccccccTTTTccHcccccHHHHHHHTTccEEEEEEEcTTTHHHHHHHHHHHH#TTcEEEcTTcEEccccccTHccHHHHHHHHHHHHcTTTcEE## PSIPRED cEEEEEEEEEcccccccccccccHHHHHHHHHHHHHHccccEEEEEEEcccccccEEEcccccccccccccccccccccccccccccccHHHcccccccccccEEEEcccccccccccccccccccccccHHHHHHHccccEEEEEEEEHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHcccEEEEHHHHHcc //