[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ppiB.1
DDBJ      :ppiB         peptidyl prolyl cis-trans isomerase
Swiss-Prot:             

Homologs  Archaea  16/68 : Bacteria  671/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
b.62.1
:169 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->149 2nulA PDBj 5e-19 40.2 %
:RPS:PDB   10->157 3bo7B PDBj 4e-34 26.4 %
:RPS:SCOP  9->168 1a33A  b.62.1.1 * 3e-27 27.2 %
:HMM:SCOP  5->167 1v9tA_ b.62.1.1 * 1.2e-44 39.7 %
:RPS:PFM   13->149 PF00160 * Pro_isomerase 3e-28 50.0 %
:HMM:PFM   12->163 PF00160 * Pro_isomerase 4e-46 42.3 142/155  
:BLT:SWISS 6->161 PPI1_BRUSU 4e-51 63.2 %
:PROS 45->62|PS00170|CSA_PPIASE_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87451.1 GT:GENE ppiB.1 GT:PRODUCT peptidyl prolyl cis-trans isomerase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1667025..1667534) GB:FROM 1667025 GB:TO 1667534 GB:DIRECTION - GB:GENE ppiB GB:PRODUCT peptidyl prolyl cis-trans isomerase GB:PROTEIN_ID AAK87451.1 GB:DB_XREF GI:15156769 GB:GENE:GENE ppiB LENGTH 169 SQ:AASEQ MTEIKDPENTIIMETTTGKVVIQLLPEVAPGHVARIKELVSEGAYDGVVFHRVIEDFMAQTGDVKFGKKGSESFNPARAGMGGSEKEDLKAEFSAIPHVRGTCSMARSQSPNSANSQFFICFTDSPWLNKQYTVWGQVIEGMEAIDKIKRGEPVKDPDSIVSIKLASAA GT:EXON 1|1-169:0| BL:SWS:NREP 1 BL:SWS:REP 6->161|PPI1_BRUSU|4e-51|63.2|155/196| PROS 45->62|PS00170|CSA_PPIASE_1|PDOC00154| BL:PDB:NREP 1 BL:PDB:REP 11->149|2nulA|5e-19|40.2|127/163| RP:PDB:NREP 1 RP:PDB:REP 10->157|3bo7B|4e-34|26.4|144/167| RP:PFM:NREP 1 RP:PFM:REP 13->149|PF00160|3e-28|50.0|126/151|Pro_isomerase| HM:PFM:NREP 1 HM:PFM:REP 12->163|PF00160|4e-46|42.3|142/155|Pro_isomerase| GO:PFM:NREP 2 GO:PFM GO:0003755|"GO:peptidyl-prolyl cis-trans isomerase activity"|PF00160|IPR002130| GO:PFM GO:0006457|"GO:protein folding"|PF00160|IPR002130| RP:SCP:NREP 1 RP:SCP:REP 9->168|1a33A|3e-27|27.2|151/174|b.62.1.1| HM:SCP:REP 5->167|1v9tA_|1.2e-44|39.7|151/0|b.62.1.1|1/1|Cyclophilin-like| OP:NHOMO 2434 OP:NHOMOORG 882 OP:PATTERN ----------------------------1-1-111---22221--1-1-1-----------1----22 113------------------1----------1---1--------1---------------------1----------2121---1--------11---1133-2-2122--------------111111211232222221112-2112221-11122212221121123122111121221333-----11111111111-111111211111111-11221-111111231111111111111111111121111-111--11111111121122222222222212222222222212222222222222221112222-211211111112122111122221111-21211111-1---------114-1344322222222222222222222222222222-22222222222-2222222222222233222222222221111111111111231-----------------------------23222211111222222222222222222222222222222222222222222222222322222222222222222121111322122222222122222-12-2-12211-1------111111111121-211222322422124444433444442444434--211-1------22222222222222122-2222222222222222222222222212222222222222222122222222-222222222222---2-----22221221211111211111111222222121112222222222222221222---------23332222223332222222222221---2112111111--------1-2------------------------------------11 3211566-6162456464544434355555535333365455553443455444246336664253-322312332323312231344-8A86665575453365714E9IFGD9A33-31384JA3C3HbB196E3433933872413561294569788F6757297A767A6189A*B8A78H8DE68A68A676C ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 168 STR:RPRED 99.4 SQ:SECSTR ccGGGcHccEEEEEETTEEEEEEEcTTTcHHHHHHHHHHHTTTTTTTccEEEEETTTEEEEccGGGcccccccccccccccccTTcccccccccTcccccccEEEEccccTTcccccEEEEccccGGGTTTccEEEEEEEcHHHHHHHTTcccccccccccccEEEEE# DISOP:02AL 1-5| PSIPRED cccccccccEEEEEEcccEEEEEEccccccHHHHHHHHHHcccccccEEEEEEEcccEEEcccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccEEEEEEcccHHHcccEEEEEEEEccHHHHHHHHcccccccccEEEEEEEEEcc //