[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ppiB.2
DDBJ      :ppiB         peptidyl prolyl cis-trans isomerase
Swiss-Prot:             

Homologs  Archaea  17/68 : Bacteria  597/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
b.62.1
:189 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   36->171 2nulA PDBj 8e-18 40.5 %
:RPS:PDB   36->167 3bo7B PDBj 2e-31 27.1 %
:RPS:SCOP  36->186 1a33A  b.62.1.1 * 1e-25 33.3 %
:HMM:SCOP  6->186 1z81A1 b.62.1.1 * 6.5e-47 41.8 %
:RPS:PFM   36->166 PF00160 * Pro_isomerase 9e-23 51.2 %
:HMM:PFM   30->184 PF00160 * Pro_isomerase 1e-46 42.9 147/155  
:BLT:SWISS 31->186 PPI1_BRUSU 5e-64 72.4 %
:PROS 63->80|PS00170|CSA_PPIASE_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87452.1 GT:GENE ppiB.2 GT:PRODUCT peptidyl prolyl cis-trans isomerase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1667571..1668140) GB:FROM 1667571 GB:TO 1668140 GB:DIRECTION - GB:GENE ppiB GB:PRODUCT peptidyl prolyl cis-trans isomerase GB:PROTEIN_ID AAK87452.1 GB:DB_XREF GI:15156770 GB:GENE:GENE ppiB LENGTH 189 SQ:AASEQ MKLVRFAFAGALFAGALAASTFASAAELLTVQLKDGPVVIELMPQVAPKHVAQIEALAKKGAYDNVAFHRVIDGFMAQTGDVQYGNMEKGFNAQRAGTGGSDMADIPAEFSKTPFTRGVVGMARSSDPNSANSQFFIMFADGPFLNGQYTVVGKVVSGMEAVDKIKRGAGGNGEVSNPDRMIKVTVGKK GT:EXON 1|1-189:0| BL:SWS:NREP 1 BL:SWS:REP 31->186|PPI1_BRUSU|5e-64|72.4|156/196| PROS 63->80|PS00170|CSA_PPIASE_1|PDOC00154| TM:NTM 1 TM:REGION 6->28| SEG 6->30|fafagalfagalaastfasaaellt| BL:PDB:NREP 1 BL:PDB:REP 36->171|2nulA|8e-18|40.5|126/163| RP:PDB:NREP 1 RP:PDB:REP 36->167|3bo7B|2e-31|27.1|129/167| RP:PFM:NREP 1 RP:PFM:REP 36->166|PF00160|9e-23|51.2|121/151|Pro_isomerase| HM:PFM:NREP 1 HM:PFM:REP 30->184|PF00160|1e-46|42.9|147/155|Pro_isomerase| GO:PFM:NREP 2 GO:PFM GO:0003755|"GO:peptidyl-prolyl cis-trans isomerase activity"|PF00160|IPR002130| GO:PFM GO:0006457|"GO:protein folding"|PF00160|IPR002130| RP:SCP:NREP 1 RP:SCP:REP 36->186|1a33A|1e-25|33.3|141/174|b.62.1.1| HM:SCP:REP 6->186|1z81A1|6.5e-47|41.8|170/0|b.62.1.1|1/1|Cyclophilin-like| OP:NHOMO 2022 OP:NHOMOORG 809 OP:PATTERN --------------------------------111---22221-2--111111-------------22 113---------------------------------2----1---1--------------11----------------2121---1-------------1-2112-112---------------111111211232122111--1-11-122111--3222221-13--12112111111111333-----111111111111111111211111111-111211------23-1111111111111111111--11--1-----------1-111---111-1111--11111111111-------------122111222--21121111111212211112221111-111111111-1----------12-1233322222222222222222222222222222-22222222222-2222222222222222122222222221111111111111221-----------------------------222222111112222222222222222222222222222222222222222212222223222222222222222221211-1322122222222122222111121121------------1111-11111-111212122412124433333433332344334--211-1------22222222222222122-2222222222222222222222222212222222222222222222222222-222222222222---1-----22221221211111211111111222222121112222222222222222222---------233322222233222----------------12----------------2------------------------------------1- 2211435-3-313443545333344445434243333543444333334433442342445443422312222231212213342334-5A45654535342386814D4E6A87922-31142A72J1AS8169J3113521452212453261345544946362768544B41879*A9975H68D5B8776545C ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 83.1 SQ:SECSTR ###############################TEEEEEEEEEEcTTTcHHHHHHHHHHHTTTTTTTccEEEEETTTEEEEccGGGccccccccccccccccTTcccccccccTcccccccEEEEccccTTcccccEEEEccccGGGTTTccEEEEEEEcHHHHHHHTTTccTTccccccEEEEEEEEEE# DISOP:02AL 169-173| PSIPRED cHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccEEEEEEccccccHHHHHHHHHHccccccccEEEEEEcccEEEEccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccEEEEEEcccHHHcccEEEEEEEEccHHHHHHHHccccccccccccEEEEEEEEEcc //