[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : prsE2.1
DDBJ      :prsE2        HlyD family secretion protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  319/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
b.1.10b.82.1b.84.1d.41.2
:437 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   60->88 3bg5B PDBj 2e-05 31.0 %
:RPS:PDB   283->351 2ejmA PDBj 4e-09 13.4 %
:RPS:SCOP  56->95 1k8mA  b.84.1.1 * 7e-04 15.0 %
:RPS:SCOP  66->107 1qpnA2  d.41.2.1 * 1e-04 26.2 %
:RPS:SCOP  278->425 1x8mA  b.82.1.13 * 7e-17 14.2 %
:HMM:SCOP  309->366 1p4uA_ b.1.10.2 * 6e-05 29.3 %
:HMM:PFM   56->367 PF00529 * HlyD 5.6e-47 29.1 302/306  
:BLT:SWISS 56->437 PRTE_ERWCH 3e-44 31.2 %
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88425.1 GT:GENE prsE2.1 GT:PRODUCT HlyD family secretion protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2689324..2690637 GB:FROM 2689324 GB:TO 2690637 GB:DIRECTION + GB:GENE prsE2 GB:PRODUCT HlyD family secretion protein GB:PROTEIN_ID AAK88425.1 GB:DB_XREF GI:15157919 GB:GENE:GENE prsE2 LENGTH 437 SQ:AASEQ MADAEKTGTTNSSILRHSAAVVVLGLGLLVGMGGWAAFAKLAGAVVATGRVVVEGNSKKIQHLSGGIVSEINVVEGDRVAAGQILLRLSATVVQANLSIIENTLAQLYSRRARLRAEIAEEPSFTVTEDLTALTSSKSAKTFIDSEQNLFNSRRNALIGMKKQLATRKLQLADEARGLDVQVEATENELAIVKEDVSKTDELLKKGLVTLQRLNLLKRQLSNLEGQQGQYIAARAQTVGKLSELDLQLLQLDEDRKSEVTKDLTSIEATVAEYEERLAATRDQLDRLDIRSPIAGRIYQLSVHNINGVIQPGEVLMLVVPDKDDLAIEANITPRDIDQIYVGQPVTVRFTAFNQSTTPDLSAEVAVVAPDLQTDSRTGTSYYVLRIRPNKAGMGHLPGGKLYPGMPAEVFIQTSERSVLSYFVKPFQDRLKKTFVQE GT:EXON 1|1-437:0| BL:SWS:NREP 1 BL:SWS:REP 56->437|PRTE_ERWCH|3e-44|31.2|378/448| COIL:NAA 73 COIL:NSEG 2 COIL:REGION 170->204| COIL:REGION 253->290| TM:NTM 1 TM:REGION 23->45| SEG 19->55|aavvvlglgllvgmggwaafaklagavvatgrvvveg| SEG 110->121|rrarlraeiaee| SEG 243->254|eldlqllqlded| RP:PDB:NREP 2 RP:PDB:REP 60->88|3bg5B|2e-05|31.0|29/1074| RP:PDB:REP 283->351|2ejmA|4e-09|13.4|67/99| HM:PFM:NREP 1 HM:PFM:REP 56->367|PF00529|5.6e-47|29.1|302/306|HlyD| RP:SCP:NREP 3 RP:SCP:REP 56->95|1k8mA|7e-04|15.0|40/87|b.84.1.1| RP:SCP:REP 66->107|1qpnA2|1e-04|26.2|42/115|d.41.2.1| RP:SCP:REP 278->425|1x8mA|7e-17|14.2|141/259|b.82.1.13| HM:SCP:REP 309->366|1p4uA_|6e-05|29.3|58/145|b.1.10.2|1/1|Clathrin adaptor appendage domain| OP:NHOMO 563 OP:NHOMOORG 322 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------1-1111122-2----------311------11---1------3541----------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------14111----11-553311-1132----------2-335332333411344225233335211-12132122532--------1-1--41111111111111111111111111111111--1111-221-3--1131----11--111-1--1-212-----241-1-1-2132112-21332--1----1-1211----21311-4111--2---11-1--------11111---------------2--11112112-12-1-11111111111112224111--111-----------211--222-12----2---------2-1-----21--4424222222122222222221--1------211121111222--2-111--1111--112111------------22222211-1113333444224334-123---------121122222232344--1-------11111-4-------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------11------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 114 STR:RPRED 26.1 SQ:SECSTR ###########################################################EEccccEEEEEEcccTTcEEcTTcEEEEE##################################################################################################################################################################################EEEEEEEEccccccccccccccccccccEEEEEEccccTTEEEccccEEEEEEccccEEEEEEccccEEEEEEcccTTEEEcTTc###################################################################################### DISOP:02AL 221-240, 434-437| PSIPRED ccccHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEcEEEEEEcccccEEEEEEcccccEEEcccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccccEEEEEEEEEcccccccccHHHEEEEEcccEEEEEEEEcHHHHHHcccccEEEEEEEEccccEEcEEEEEEEEEcccccccccccEEEEEEEEEEcHHHHccccccEEEEccEEEEEEEEccEEHHHHHHHHHHHHHHHHHccc //