[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ptsH
DDBJ      :ptsH         phosphocarrier protein HPr
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  222/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.94.1
:91 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->69 2rlzA PDBj 7e-09 47.4 %
:RPS:PDB   4->69 1cm3A PDBj 9e-15 30.3 %
:RPS:SCOP  4->69 1cm2A  d.94.1.1 * 3e-14 31.8 %
:HMM:SCOP  4->90 2nzuL1 d.94.1.1 * 1.3e-25 48.3 %
:RPS:PFM   4->69 PF00381 * PTS-HPr 7e-10 47.0 %
:HMM:PFM   5->85 PF00381 * PTS-HPr 1.9e-29 43.2 81/84  
:BLT:SWISS 4->89 PTHP_RALEH 2e-14 44.2 %
:PROS 15->22|PS00369|PTS_HPR_HIS
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85854.1 GT:GENE ptsH GT:PRODUCT phosphocarrier protein HPr GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(33411..33686) GB:FROM 33411 GB:TO 33686 GB:DIRECTION - GB:GENE ptsH GB:PRODUCT phosphocarrier protein HPr GB:PROTEIN_ID AAK85854.1 GB:DB_XREF GI:15154893 GB:GENE:GENE ptsH LENGTH 91 SQ:AASEQ MSPLSRELPIINKRGLHARASAKFVQMVEGFDATITVSKDGMTVGGTSIMGLMMLAASPGCSVYVEASGNQAVEALAALEALVANRFGEEA GT:EXON 1|1-91:0| BL:SWS:NREP 1 BL:SWS:REP 4->89|PTHP_RALEH|2e-14|44.2|86/89| PROS 15->22|PS00369|PTS_HPR_HIS|PDOC00318| SEG 72->84|avealaalealva| BL:PDB:NREP 1 BL:PDB:REP 13->69|2rlzA|7e-09|47.4|57/85| RP:PDB:NREP 1 RP:PDB:REP 4->69|1cm3A|9e-15|30.3|66/84| RP:PFM:NREP 1 RP:PFM:REP 4->69|PF00381|7e-10|47.0|66/83|PTS-HPr| HM:PFM:NREP 1 HM:PFM:REP 5->85|PF00381|1.9e-29|43.2|81/84|PTS-HPr| GO:PFM:NREP 2 GO:PFM GO:0005351|"GO:sugar:hydrogen symporter activity"|PF00381|IPR005698| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF00381|IPR005698| RP:SCP:NREP 1 RP:SCP:REP 4->69|1cm2A|3e-14|31.8|66/85|d.94.1.1| HM:SCP:REP 4->90|2nzuL1|1.3e-25|48.3|87/0|d.94.1.1|1/1|HPr-like| OP:NHOMO 225 OP:NHOMOORG 224 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----1--1111-1111111111111111111111111111-11111111111-11111111111111--11111111111---------11111-1------------------------------111111111111111111111111111111111111111111111-11111111111111111111111111111----------------1111111111111-1---------------------------11----11-1--1--------------1-------11-1--------------------------------------------------------------------------------------------------1111--1-1---------------------------11111-1--1111--1--------------1111111111111111111111111--------------------------------------------------------111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 67 STR:RPRED 73.6 SQ:SECSTR ###cEEEEEEcccccccHHHHHHHHHHHHTcccEEEEEETTEEEETTcHHHHTTccccTTcEEEEEEEcc##################### DISOP:02AL 1-2, 89-91| PSIPRED cccEEEEEEEEccccccccHHHHHHHHHHccccEEEEEEccEEEcHHHHHHHHHHccccccEEEEEEEcHHHHHHHHHHHHHHHHcccccc //