[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : purH
DDBJ      :purH         bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
Swiss-Prot:PUR9_AGRT5   RecName: Full=Bifunctional purine biosynthesis protein purH;Includes:  RecName: Full=Phosphoribosylaminoimidazolecarboxamide formyltransferase;           EC=2.1.2.3;  AltName: Full=AICAR transformylase;Includes:  RecName: Full=IMP cyclohydrolase;           EC=3.5.4.10;  AltName: Full=Inosinicase;  AltName: Full=IMP synthetase;  AltName: Full=ATIC;

Homologs  Archaea  21/68 : Bacteria  827/915 : Eukaryota  185/199 : Viruses  1/175   --->[See Alignment]
c.24.1c.97.1
:538 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->453,481->538 1m9nA PDBj 3e-68 41.0 %
:RPS:PDB   15->159 1b93C PDBj 6e-19 20.0 %
:RPS:SCOP  15->209 1g8mA1  c.24.1.3 * 2e-45 42.8 %
:RPS:SCOP  223->538 1zczA2  c.97.1.4 * 2e-69 35.2 %
:HMM:SCOP  15->210 1g8mA1 c.24.1.3 * 2.9e-74 52.8 %
:HMM:SCOP  220->538 1g8mA2 c.97.1.4 * 1e-135 57.5 %
:RPS:PFM   29->141 PF02142 * MGS 1e-09 46.7 %
:RPS:PFM   147->455 PF01808 * AICARFT_IMPCHas 1e-88 57.9 %
:HMM:PFM   148->463 PF01808 * AICARFT_IMPCHas 1.1e-121 53.5 312/315  
:HMM:PFM   29->141 PF02142 * MGS 2.2e-26 43.5 92/95  
:BLT:SWISS 1->538 PUR9_AGRT5 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88535.2 GT:GENE purH GT:PRODUCT bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2826329..2827945) GB:FROM 2826329 GB:TO 2827945 GB:DIRECTION - GB:GENE purH GB:PRODUCT bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase GB:PROTEIN_ID AAK88535.2 GB:DB_XREF GI:159140649 GB:GENE:GENE purH LENGTH 538 SQ:AASEQ MAVVSKKIPAPDKVKIRTALLSVSDKTDIIELATVLSKLGVKLLSTGGTAKAIAEAGLAVTDVSDVTNFPEIMDGRVKTLHPNVHGGLLAIRDDAEHVEAMKAHGIEAIDLSVINLYPFEEVRAKGGDYPTTVENIDIGGPAMIRASAKNHAYVTVVTDPSDYPALVEALQADDGQTSYALRQRFAAKAYARTAAYDAVISNWFAEALAIETPHYRAIGGVLKEKMRYGENPHQSAGFYLTGEKRPGVATATLLQGKQLSYNNINDTDAAYELVAEFLPENAPAVAIVKHANPCGVATGPTLAEAYRRALACDSVSAFGGVIALNRTLDAETAEEIVKLFTEVIIAPDVTEEAKSIIARKPNLRLLAAGGLPDPRAAGLTAKTVSGGLLVQSRDNGMVEDLELKVVTKRAPTAQELEDMKFAFKIAKHVKSNAVIYAKDGQTAGIGAGQMSRVDSARIAAQKAEDAAKALGLAEPLTRGSAVASEAFYPFADGLLAAIAAGATAVIQPGGSMRDQDVIDAANEHNVAMVFTGMRHFRH GT:EXON 1|1-538:0| SW:ID PUR9_AGRT5 SW:DE RecName: Full=Bifunctional purine biosynthesis protein purH;Includes: RecName: Full=Phosphoribosylaminoimidazolecarboxamide formyltransferase; EC=2.1.2.3; AltName: Full=AICAR transformylase;Includes: RecName: Full=IMP cyclohydrolase; EC=3.5.4.10; AltName: Full=Inosinicase; AltName: Full=IMP synthetase; AltName: Full=ATIC; SW:GN Name=purH; OrderedLocusNames=Atu2823; ORFNames=AGR_C_5117; SW:KW Complete proteome; Hydrolase; Multifunctional enzyme;Purine biosynthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->538|PUR9_AGRT5|0.0|100.0|538/538| GO:SWS:NREP 4 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0003824|"GO:catalytic activity"|Multifunctional enzyme| GO:SWS GO:0006164|"GO:purine nucleotide biosynthetic process"|Purine biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 186->198|aakayartaayda| SEG 456->469|ariaaqkaedaaka| SEG 491->504|adgllaaiaagata| BL:PDB:NREP 1 BL:PDB:REP 19->453,481->538|1m9nA|3e-68|41.0|478/590| RP:PDB:NREP 1 RP:PDB:REP 15->159|1b93C|6e-19|20.0|120/144| RP:PFM:NREP 2 RP:PFM:REP 29->141|PF02142|1e-09|46.7|92/95|MGS| RP:PFM:REP 147->455|PF01808|1e-88|57.9|304/313|AICARFT_IMPCHas| HM:PFM:NREP 2 HM:PFM:REP 148->463|PF01808|1.1e-121|53.5|312/315|AICARFT_IMPCHas| HM:PFM:REP 29->141|PF02142|2.2e-26|43.5|92/95|MGS| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01808|IPR013982| GO:PFM GO:0006188|"GO:IMP biosynthetic process"|PF01808|IPR013982| RP:SCP:NREP 2 RP:SCP:REP 15->209|1g8mA1|2e-45|42.8|194/197|c.24.1.3| RP:SCP:REP 223->538|1zczA2|2e-69|35.2|287/295|c.97.1.4| HM:SCP:REP 15->210|1g8mA1|2.9e-74|52.8|195/197|c.24.1.3|1/1|Methylglyoxal synthase-like| HM:SCP:REP 220->538|1g8mA2|1e-135|57.5|315/393|c.97.1.4|1/1|Cytidine deaminase-like| OP:NHOMO 1126 OP:NHOMOORG 1034 OP:PATTERN ------------------------11111111-----------1111111111--------111---- 1111111111111111111-1111111111111111111111111111111111111111211111111111111111111111112122221111---11111111111---------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111-1-111111111111111111111111111111111111-1111111111-1111111111111122111111111112221111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111222222222222221212111111111111211111111111-1-------11111111111111111111111111111111111111-1111111-11111111111111111111-111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111--------1---------------------------2-22212111111 ----111-----2211111111111111111111111111111111111111111111111111111111121112222211111111-12111141111111111-13-11211121111111111116C1-12211111113211111111111111123111-111111231121181111121221111121111 -----------------------2------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 521 STR:RPRED 96.8 SQ:SECSTR ####HHHHHHHHHHcccEEEEEEcGHHHHHHHHHHTHHHHcEEEEETTHHHHHHHHHcccEEEccGGGcccHHHHHHTTEccGGGTHHHHHHHHHcccHHHHHHHTTcccEEEEEccTTcccTTHHHHHHHHHTTccEHHHHHHTcGGGGccEEEEEEcHHHHHHHHTcGGGGccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEcc#cTTTEEEccccccTTcccEEEccccccc##cEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccEEEEEETTEEEEEEEccHHHHHHHHHHHccTTTTTTEEEEEcccccHHHHHHHHTccEEEEEEccccHHHHHHHHTGGGGTcEEEEEcTTcccccEEEEEETTEEEEEEcccccccGGGGcccccccccccHHHHHHHHHHHHHTcccccEEEEETTEEEEEEcccccHHHHHHHHHH##########HHTTcccEEEEEEccccccTHHHHHHHTTTEEEEEEEcccTTHHHHHHHHHHTTcEEEEEccccccc DISOP:02AL 1-7,10-10,538-539| PSIPRED cccccccccccccccEEEEEEEEcccccHHHHHHHHHHcccEEEEEHHHHHHHHHccccEEEHHHHccccccccccEEEEcHHHHHHHHHccccHHHHHHHHHcccccEEEEEEEcccHHHHHcccccHHHHHHHccccHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEccccccccccccccEEEEcccccccccEEEEccccccHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccHHHHHHHHHHcccccccccEEEEcccccHHHHHHHHHHEEEEEEcccccHHHHHHHHHccccEEEEEccccccccccEEEEEEcccEEEEEcccccccHHHHcccccccccHHHHHHHHHHHHHHHHHcccEEEEEEccEEEEEccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccccHHHHHHHcccEEEEEccccccHHHHHHHHHHcccEEEEcccccccc //