[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : purQ
DDBJ      :purQ         phosphoribosylformylglycinamidine synthase I
Swiss-Prot:             

Homologs  Archaea  58/68 : Bacteria  762/915 : Eukaryota  99/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:207 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   23->205 3d54D PDBj 4e-40 47.7 %
:RPS:PDB   12->202 3d54D PDBj 3e-26 44.4 %
:RPS:SCOP  13->202 1l9xA  c.23.16.1 * 5e-23 17.6 %
:HMM:SCOP  1->206 1t3tA2 c.23.16.1 * 1e-60 44.6 %
:RPS:PFM   23->84 PF07685 * GATase_3 1e-13 61.0 %
:HMM:PFM   22->78 PF07685 * GATase_3 8.5e-11 38.9 54/158  
:BLT:SWISS 1->207 PURQ_RHIME e-104 86.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87612.1 GT:GENE purQ GT:PRODUCT phosphoribosylformylglycinamidine synthase I GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1825991..1826614 GB:FROM 1825991 GB:TO 1826614 GB:DIRECTION + GB:GENE purQ GB:PRODUCT phosphoribosylformylglycinamidine synthase I GB:PROTEIN_ID AAK87612.1 GB:DB_XREF GI:15156958 GB:GENE:GENE purQ LENGTH 207 SQ:AASEQ MIAALTKISGQAPVTIWQTETDIPDVDLIVIPGGFSYGDYLRCGAIAARMPVMQAIREKAEQGVKVLGVCNGFQILVEAGMLPGALMRNASLKFVCREVKLEVANNDTEFTRAYDRGQILRCPVAHHDGNYFLDTDELKSVEDNRQVVFRYAEGTNPNGSLNDIAGVINAKGNVLGMMPHPENLIEAAHGGNDGRGLFASALGVIAA GT:EXON 1|1-207:0| BL:SWS:NREP 1 BL:SWS:REP 1->207|PURQ_RHIME|e-104|86.5|207/223| BL:PDB:NREP 1 BL:PDB:REP 23->205|3d54D|4e-40|47.7|172/211| RP:PDB:NREP 1 RP:PDB:REP 12->202|3d54D|3e-26|44.4|180/211| RP:PFM:NREP 1 RP:PFM:REP 23->84|PF07685|1e-13|61.0|59/151|GATase_3| HM:PFM:NREP 1 HM:PFM:REP 22->78|PF07685|8.5e-11|38.9|54/158|GATase_3| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF07685|IPR011698| GO:PFM GO:0009236|"GO:cobalamin biosynthetic process"|PF07685|IPR011698| RP:SCP:NREP 1 RP:SCP:REP 13->202|1l9xA|5e-23|17.6|188/288|c.23.16.1| HM:SCP:REP 1->206|1t3tA2|1e-60|44.6|204/0|c.23.16.1|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 926 OP:NHOMOORG 919 OP:PATTERN --11--1-11111111-1111111111111111111111111111-1111111111111-1111--11 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111---1-----11-1----------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111-1-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-1111111111-1111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---------------111111111111111------1------1---------1111111111--1-11-1111------1-11111111111-111111-11---111-11111111111111--1111111111111-1-------1111111111111--111-1111111111111111111-11111------11111111111111111-1111111111111-111111111111111111111111111111111111111111111111111--11111111111-1111111111-1111111111111111111111111111111111111111111111111111111111111111-1--1111111-111111111--------1---------------------------1-111111111-1 ------1-----111-1--11111111111111111-11111111111111111---1-111111-11-11111111-11111111-1-11111-2111-1-1111-11------------------------------------------------1-1--1---13111---------11----12--11111---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 207 STR:RPRED 100.0 SQ:SECSTR HHHHHTTccTTcEEEEEcTTcccccccEEEEcEEcGGGGcccTTHHHHTcTTHHHHHHHHHHTcEEEEcHHHHHHHHHTEccccEEEccccccccccEEEEEEcccccTTcTTccTTcEEEEEccccccEEEcccccEEEccTTcEEEEEEcEEccccccGGGEEEEEcccccEEEEccccTTTTcTTTTccTTcHHHHHHHHHHHH PSIPRED cHHHHHHHcccccEEEEcccccHHHccEEEEccccccccHHHHHHHHHHcccHHHHHHHHHccccEEEEEcHHHHHHHccccccEEEEcccccEEccEEEEEEcccccHHHcccccccEEEEEEEEccEEEEccHHHHHHHHHcccEEEEEccccccccccccEEEEEcccccEEEEccccHHHEEcccccccHHHHHHHHHHHHHc //