[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : pyrC.2
DDBJ      :pyrC         dihydroorotase
Swiss-Prot:             

Homologs  Archaea  62/68 : Bacteria  700/915 : Eukaryota  117/199 : Viruses  0/175   --->[See Alignment]
b.92.1c.1.9
:430 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   6->427 3d6nA PDBj 2e-76 37.3 %
:RPS:PDB   5->427 3d6nA PDBj 5e-56 36.2 %
:RPS:SCOP  6->89 1ymyA1  b.92.1.5 * 7e-09 26.6 %
:RPS:SCOP  62->370 1gkrA2  c.1.9.6 * 2e-67 26.9 %
:RPS:SCOP  358->427 2icsA1  b.92.1.8 * 1e-09 17.5 %
:HMM:SCOP  3->101 1onwA1 b.92.1.7 * 2.5e-13 30.5 %
:HMM:SCOP  62->375 1k1dA2 c.1.9.6 * 1.1e-91 41.1 %
:HMM:SCOP  323->428 1nfgA1 b.92.1.3 * 1.4e-12 28.3 %
:RPS:PFM   58->107 PF01979 * Amidohydro_1 2e-09 50.0 %
:HMM:PFM   59->386 PF01979 * Amidohydro_1 2.2e-19 16.7 299/328  
:BLT:SWISS 6->427 PYRC_GEOBB 5e-91 42.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87098.1 GT:GENE pyrC.2 GT:PRODUCT dihydroorotase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1298997..1300289) GB:FROM 1298997 GB:TO 1300289 GB:DIRECTION - GB:GENE pyrC GB:PRODUCT dihydroorotase GB:PROTEIN_ID AAK87098.1 GB:DB_XREF GI:15156360 GB:GENE:GENE pyrC LENGTH 430 SQ:AASEQ MSAVTVLKNLRIVDPSRNLDETGSIVIGADGTILAAGKDAHNQGAPDGATVRDCTGIVAVPGLVDARVFVGEPGGEHRETIESASRAAAAGGVTSIIVMPDTDPVIDDIALVEYVKKTARDKAIVNVHPAAALTKGLRGEEMTEFGMLKEAGAVAFTNGRKALSDTLVLRRAMTYARELGAVIALETRDKYIGGGDMNEGLFASWLGLSGVPKEAEIIPLERDLRIAGLTQAIYHAAKISVPESAEAIRIARQRGVKATCGISINHLTLNENDIGEYRTFFKLSPPLRAEDDRKAMVEALKDGTIDIIVSSHDPQDVDTKRLPFSDAASGAVGLETMLAAALRLYHSGEVPLMRLIDALSTRPAKIFGLDAGTLKAGAKADITLIDLDEPWLVARDQLVSKSKNTPFEDARFSGRAVATYVAGKAVHSLA GT:EXON 1|1-430:0| BL:SWS:NREP 1 BL:SWS:REP 6->427|PYRC_GEOBB|5e-91|42.6|418/424| BL:PDB:NREP 1 BL:PDB:REP 6->427|3d6nA|2e-76|37.3|416/422| RP:PDB:NREP 1 RP:PDB:REP 5->427|3d6nA|5e-56|36.2|417/422| RP:PFM:NREP 1 RP:PFM:REP 58->107|PF01979|2e-09|50.0|50/271|Amidohydro_1| HM:PFM:NREP 1 HM:PFM:REP 59->386|PF01979|2.2e-19|16.7|299/328|Amidohydro_1| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF01979|IPR006680| RP:SCP:NREP 3 RP:SCP:REP 6->89|1ymyA1|7e-09|26.6|79/85|b.92.1.5| RP:SCP:REP 62->370|1gkrA2|2e-67|26.9|305/325|c.1.9.6| RP:SCP:REP 358->427|2icsA1|1e-09|17.5|63/101|b.92.1.8| HM:SCP:REP 3->101|1onwA1|2.5e-13|30.5|95/106|b.92.1.7|1/1|Composite domain of metallo-dependent hydrolases| HM:SCP:REP 62->375|1k1dA2|1.1e-91|41.1|314/332|c.1.9.6|1/1|Metallo-dependent hydrolases| HM:SCP:REP 323->428|1nfgA1|1.4e-12|28.3|106/128|b.92.1.3|1/1|Composite domain of metallo-dependent hydrolases| OP:NHOMO 1249 OP:NHOMOORG 879 OP:PATTERN 11211111111111121111---121111131111111111111111-1111111111111-111-11 1131211111111111111-1211111111111111111212112121111122321111112131222212111111111151111111111111---12222242212---------------11111111111111111111122222212222-1111-11222332-11----1----122111111121111111111111113222121111211111111111121111111111111112111131-111111111111111111111111111111111111111111111111111111111111111111112213222222222213221111231311211175121111221111111112222222222223432222222222332333333-22322323332132233325533242-22233333332133333333233222121111111111---------------11112112122221-1332311111111221111113112233--221111111131221121111---------11111111111111111111111111111111111312-11111111111111111111111-22211-1-2-----------1--------------1111----------1--1111121211--112111111-2111111---2-----1-111-1111111111-----------------------------------123-1---------------11111121111-222332322131111111111111112---1-----1----11111111111111--12111111--------1--------------------2------1121-11111211 ----32---11----2-11---11111------1111---1----------11---------12111111-111111111111111---121-1111-111--111-131417225-111111-42-11261-211-1--1-11------1--3-1113---1212112251241-11-6---113113111--1---2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 429 STR:RPRED 99.8 SQ:SECSTR GcEEEEEEccEEEEGGGTEEEccEEEEcETTEEEEEEcccccEEccTTcEEEEcTTcEEEEcEEEEEEcccTTTcTTTccHHHHHHHHHHTTEEEEEEccccccccccHHHHHHHHHHHHHHcccEEEEcccccGGGcccccccHHHHHHHTccccccTTcccccHHHHHHHHHHHHHTTccEEEccccTTTccccEETTHHHHHHcccEEcHHHHHHHHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHTTTccEEEEEcHHHHHccTTHHHHHGGGGccccccccHHHHHHHHHHHHTTcccEEccccccccHGGGcccGGGcccccccTTTHHHHHHHHHHTTcccHHHHHHTTTHHHHHHHTcccccccTTccccEEEEEEEEEEEccTTTccccccccTTTTcEEEEEEEEEEETTEEEEET# PSIPRED ccccEEEEccEEEcccccEEEcccEEEEcccEEEEEEccccccccccccEEEEccccEEEEccccHHHHcccccccccccHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHHHHHcccccEEEEEccccccccccccHHHHHHHHHccEEEEEEcccccccHHHHHHHHHHHHHcccEEEEEcccHHHccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHccccEEEEEccHHEEccHHHHHHcccEEEEccccccHHHHHHHHHHHHccccEEEEcccccccHHHHcccHHHcccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccEEccccccEEEEcccccEEccHHHHHccccccccccEEEEEEEEEEEEccEEEEEcc //