[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : rbsC.1
DDBJ      :rbsC         ABC transporter, membrane spanning protein (ribose)
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  375/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
:326 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   51->264 PF02653 * BPD_transp_2 6e-12 33.5 %
:HMM:PFM   51->316 PF02653 * BPD_transp_2 6.5e-55 36.5 260/267  
:BLT:SWISS 25->262 RBSC_BACSU 1e-36 42.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87662.1 GT:GENE rbsC.1 GT:PRODUCT ABC transporter, membrane spanning protein (ribose) GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1876887..1877867) GB:FROM 1876887 GB:TO 1877867 GB:DIRECTION - GB:GENE rbsC GB:PRODUCT ABC transporter, membrane spanning protein (ribose) GB:PROTEIN_ID AAK87662.1 GB:DB_XREF GI:15157017 GB:GENE:GENE rbsC LENGTH 326 SQ:AASEQ MSALERNEGVTHTRSPLAWLSGATGPLLGLLMLCVFLTFASENFLSLRNGLNILDQITVLGIMAVGMTFVILLGGIDLSVGSVLALSMMIMGWTANVAGMPMGMAIVLALVASAACGLVVGILVTAFRVPAFIATLAMMSVARGLANMITDGQQIVGFPDWFMMLAIERHFGVLTATVLLMLVVVLVSWAFLRFRSEGRTVYAVGGNPEVARLAGINVPLVTICVYVVCAVLAGLAGIVLAARLDSVQPSSGFGYELDTIAAVVIGGTSLSGGAGGIGGTLIGVLIIGVLRNGLNLLNVSPFLQQVIIGVVIVLAVGAETLRRRRS GT:EXON 1|1-326:0| BL:SWS:NREP 1 BL:SWS:REP 25->262|RBSC_BACSU|1e-36|42.2|237/322| TM:NTM 7 TM:REGION 21->43| TM:REGION 61->83| TM:REGION 109->131| TM:REGION 172->193| TM:REGION 218->240| TM:REGION 273->295| TM:REGION 299->320| SEG 173->187|vltatvllmlvvvlv| SEG 224->242|cvyvvcavlaglagivlaa| SEG 265->299|iggtslsggaggiggtligvliigvlrnglnllnv| SEG 303->318|lqqviigvvivlavga| RP:PFM:NREP 1 RP:PFM:REP 51->264|PF02653|6e-12|33.5|212/271|BPD_transp_2| HM:PFM:NREP 1 HM:PFM:REP 51->316|PF02653|6.5e-55|36.5|260/267|BPD_transp_2| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF02653|IPR001851| GO:PFM GO:0006810|"GO:transport"|PF02653|IPR001851| GO:PFM GO:0016020|"GO:membrane"|PF02653|IPR001851| OP:NHOMO 1674 OP:NHOMOORG 381 OP:PATTERN --------1-1-----1--------------------------------------------------- -1226---111-----------11-7-------111-14-11-1311-243-523--1--11213247331-----211---7------------------------2-2--------------------------43313---2---------------------11-2-------------2----44-421333323231342334221121332-44-121------13------------------11-1--11----------1------1-1111-1-1------------------------------------1-4--4-----1-11122--11116221-1--1----1-221-3213211---2-11------2-979--------4355455455G------1-12I--NGGDLEONPIQR11---5767266442--------A33----1----------------------------------------B777786555466DC766636569-31---33-5-2--21148E-------11---------------1-------1------------------4-----------------------------356--2----3----2--52222--2-2---------------84563757886764656-8767646666876777778ECE671113233333333333323953553542-AGGGHGGGFHHH---------------218322524-11333696----------221111-226------444----------11142222212122------------------------------------------------111---------1131-26262-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-15, 325-326| PSIPRED ccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccHHHHEEEEEcccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccc //