[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : rnpA
DDBJ      :rnpA         ribonuclease P protein component
Swiss-Prot:RNPA_AGRT5   RecName: Full=Ribonuclease P protein component;         Short=RNaseP protein;         Short=RNase P protein;         EC=3.1.26.5;AltName: Full=Protein C5;

Homologs  Archaea  0/68 : Bacteria  56/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.14.1
:127 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->106 1a6fA PDBj 7e-08 36.1 %
:RPS:PDB   10->103 1d6tA PDBj 2e-11 22.8 %
:RPS:SCOP  10->103 1a6fA  d.14.1.2 * 3e-11 28.3 %
:HMM:SCOP  3->121 1d6tA_ d.14.1.2 * 1.2e-23 32.5 %
:RPS:PFM   10->114 PF00825 * Ribonuclease_P 3e-07 37.5 %
:HMM:PFM   9->106 PF00825 * Ribonuclease_P 1.6e-25 38.1 97/111  
:BLT:SWISS 1->127 RNPA_AGRT5 5e-68 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86201.2 GT:GENE rnpA GT:PRODUCT ribonuclease P protein component GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(377862..378245) GB:FROM 377862 GB:TO 378245 GB:DIRECTION - GB:GENE rnpA GB:PRODUCT ribonuclease P protein component GB:PROTEIN_ID AAK86201.2 GB:DB_XREF GI:159139610 GB:GENE:GENE rnpA LENGTH 127 SQ:AASEQ MSETKKQPGRLKNRSEFLAVQAGEKRRGSTFLVEVLDRRAPETEPRVGFTVTKRQGNAVERNRMRRRLKEAVRLSAGVAMKPGHDYVIVARRDVLDTAFPKLQSLLIERIEGTAKPKRSQETRSRKE GT:EXON 1|1-127:0| SW:ID RNPA_AGRT5 SW:DE RecName: Full=Ribonuclease P protein component; Short=RNaseP protein; Short=RNase P protein; EC=3.1.26.5;AltName: Full=Protein C5; SW:GN Name=rnpA; OrderedLocusNames=Atu0385; ORFNames=AGR_C_675; SW:KW Complete proteome; Endonuclease; Hydrolase; Nuclease; RNA-binding;tRNA processing. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->127|RNPA_AGRT5|5e-68|100.0|127/127| GO:SWS:NREP 5 GO:SWS GO:0004519|"GO:endonuclease activity"|Endonuclease| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0004518|"GO:nuclease activity"|Nuclease| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| BL:PDB:NREP 1 BL:PDB:REP 6->106|1a6fA|7e-08|36.1|97/113| RP:PDB:NREP 1 RP:PDB:REP 10->103|1d6tA|2e-11|22.8|92/117| RP:PFM:NREP 1 RP:PFM:REP 10->114|PF00825|3e-07|37.5|104/111|Ribonuclease_P| HM:PFM:NREP 1 HM:PFM:REP 9->106|PF00825|1.6e-25|38.1|97/111|Ribonuclease_P| GO:PFM:NREP 3 GO:PFM GO:0000049|"GO:tRNA binding"|PF00825|IPR000100| GO:PFM GO:0004526|"GO:ribonuclease P activity"|PF00825|IPR000100| GO:PFM GO:0008033|"GO:tRNA processing"|PF00825|IPR000100| RP:SCP:NREP 1 RP:SCP:REP 10->103|1a6fA|3e-11|28.3|92/113|d.14.1.2| HM:SCP:REP 3->121|1d6tA_|1.2e-23|32.5|117/117|d.14.1.2|1/1|Ribosomal protein S5 domain 2-like| OP:NHOMO 56 OP:NHOMOORG 56 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1---1----------1------1-------------------------------------------------------------------------------------------111-----1--------------1----------11---------------------------111111111----------11111111111---1--1--11-1111111111111----111------1-------------------------------------------------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 106 STR:RPRED 83.5 SQ:SECSTR #####cGGGcccccHHHHHHHHHcEEcccccEEcEEccTTccccccEEEEcccccccTTHHHHHHHHHHHHHHHGGTTGTcccccEEEEEccGGGGccTTHHHHHH#TTccc############### DISOP:02AL 1-11,111-128| PSIPRED ccHHHHHHcccccHHHHHHHHHccccccccEEEEEEEccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccccccHHHHHHHHHHHHHHHcccccccccccccc //