[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : rnpO
DDBJ      :rnpO         DNA-directed RNA polymerase omega subunit
Swiss-Prot:RPOZ_AGRT5   RecName: Full=DNA-directed RNA polymerase subunit omega;         Short=RNAP omega subunit;         EC=2.7.7.6;AltName: Full=Transcriptase subunit omega;AltName: Full=RNA polymerase omega subunit;

Homologs  Archaea  0/68 : Bacteria  367/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.143.1
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   6->63 2e2iF PDBj 9e-13 19.0 %
:RPS:SCOP  2->84 1iw7E  a.143.1.1 * 3e-17 16.9 %
:HMM:SCOP  1->83 1i6vE_ a.143.1.1 * 1.2e-23 39.8 %
:RPS:PFM   7->55 PF01192 * RNA_pol_Rpb6 5e-07 51.0 %
:HMM:PFM   7->61 PF01192 * RNA_pol_Rpb6 4.2e-21 40.0 55/57  
:HMM:PFM   61->79 PF03776 * MinE 0.00061 42.1 19/70  
:BLT:SWISS 1->129 RPOZ_AGRT5 3e-71 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86837.2 GT:GENE rnpO GT:PRODUCT DNA-directed RNA polymerase omega subunit GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1022139..1022528 GB:FROM 1022139 GB:TO 1022528 GB:DIRECTION + GB:GENE rnpO GB:PRODUCT DNA-directed RNA polymerase omega subunit GB:PROTEIN_ID AAK86837.2 GB:DB_XREF GI:159139887 GB:GENE:GENE rnpO LENGTH 129 SQ:AASEQ MARVTVEDCIDKVDNRFELVLLASHRARQISQGSSITVDRDNDKNPVVALREIADETLSPDDLKEDLIHSLQKHVEVDEPEPDPVTLAASAADGEDDDQPETVTFDQMSEEELLAGIEGLVPPEKNDDY GT:EXON 1|1-129:0| SW:ID RPOZ_AGRT5 SW:DE RecName: Full=DNA-directed RNA polymerase subunit omega; Short=RNAP omega subunit; EC=2.7.7.6;AltName: Full=Transcriptase subunit omega;AltName: Full=RNA polymerase omega subunit; SW:GN Name=rpoZ; Synonyms=rnpO; OrderedLocusNames=Atu1029;ORFNames=AGR_C_1894; SW:KW Complete proteome; DNA-directed RNA polymerase;Nucleotidyltransferase; Transcription; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->129|RPOZ_AGRT5|3e-71|100.0|129/129| GO:SWS:NREP 4 GO:SWS GO:0003899|"GO:DNA-directed RNA polymerase activity"|DNA-directed RNA polymerase| GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| RP:PDB:NREP 1 RP:PDB:REP 6->63|2e2iF|9e-13|19.0|58/86| RP:PFM:NREP 1 RP:PFM:REP 7->55|PF01192|5e-07|51.0|49/57|RNA_pol_Rpb6| HM:PFM:NREP 2 HM:PFM:REP 7->61|PF01192|4.2e-21|40.0|55/57|RNA_pol_Rpb6| HM:PFM:REP 61->79|PF03776|0.00061|42.1|19/70|MinE| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF01192|IPR006110| GO:PFM GO:0003899|"GO:DNA-directed RNA polymerase activity"|PF01192|IPR006110| GO:PFM GO:0006351|"GO:transcription, DNA-dependent"|PF01192|IPR006110| RP:SCP:NREP 1 RP:SCP:REP 2->84|1iw7E|3e-17|16.9|83/95|a.143.1.1| HM:SCP:REP 1->83|1i6vE_|1.2e-23|39.8|83/0|a.143.1.1|1/1|RPB6/omega subunit-like| OP:NHOMO 367 OP:NHOMOORG 367 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-111111111111111111-1111111111111111111111111111111-1111---11111---------------------1111111111111111111111111111111111111111111111111111111111111111-------11111111---------11--1111111-1111111---------------------------11---11111-11-------------------1-11111------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111--111111111-111111---11--1111-11-111111111111111111111111111111111111111111111111-1111111111111-1111111-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 59 STR:RPRED 45.7 SQ:SECSTR #####ccccccccccHHHHHHHHHHHHHHHTTccccccccccccTTHHHHHHHHTTccccEEEE################################################################# DISOP:02AL 1-1,87-104,124-130| PSIPRED cccccHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccHHHccHHHHHHHHHccccccccccc //