[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ropB
DDBJ      :ropB         outer membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  53/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.4.1
:218 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   107->218 3dzmC PDBj 3e-05 15.2 %
:RPS:SCOP  83->188 1qjpA  f.4.1.1 * 2e-08 21.7 %
:HMM:SCOP  43->218 1g90A_ f.4.1.1 * 4.2e-26 32.9 %
:RPS:PFM   111->218 PF01389 * OmpA_membrane 8e-05 36.9 %
:HMM:PFM   39->218 PF01389 * OmpA_membrane 1.7e-07 23.5 170/200  
:HMM:PFM   1->54 PF02530 * Porin_2 0.00066 32.1 53/402  
:BLT:SWISS 1->218 ROPB_RHILV 7e-51 51.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86934.1 GT:GENE ropB GT:PRODUCT outer membrane protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1120603..1121259 GB:FROM 1120603 GB:TO 1121259 GB:DIRECTION + GB:GENE ropB GB:PRODUCT outer membrane protein GB:PROTEIN_ID AAK86934.1 GB:DB_XREF GI:15156164 GB:GENE:GENE ropB LENGTH 218 SQ:AASEQ MRIFVATLMASTMAAAGFSAAYAADAVNEVPQAPVAYDQPAAVKDWSGAYLGGTVNYDWGRFSSSNDGRDAKGFGGGVYGGYNMQSGQIVYGAEADVNMGDEKGSAGTVAGRAVEGKQGVNGSLRGRVGYDMNPFLLYGTAGLAVSDNKVRDGVNKDSATALGYTVGAGVEAMVTDNITARLEYRYSDYQKKDYTLGNDAFSRGFDDHSVKAGIGVKF GT:EXON 1|1-218:0| BL:SWS:NREP 1 BL:SWS:REP 1->218|ROPB_RHILV|7e-51|51.4|210/211| SEG 10->26|astmaaagfsaayaada| SEG 73->82|gfgggvyggy| RP:PDB:NREP 1 RP:PDB:REP 107->218|3dzmC|3e-05|15.2|112/202| RP:PFM:NREP 1 RP:PFM:REP 111->218|PF01389|8e-05|36.9|103/188|OmpA_membrane| HM:PFM:NREP 2 HM:PFM:REP 39->218|PF01389|1.7e-07|23.5|170/200|OmpA_membrane| HM:PFM:REP 1->54|PF02530|0.00066|32.1|53/402|Porin_2| GO:PFM:NREP 2 GO:PFM GO:0009279|"GO:cell outer membrane"|PF01389|IPR000498| GO:PFM GO:0016021|"GO:integral to membrane"|PF01389|IPR000498| RP:SCP:NREP 1 RP:SCP:REP 83->188|1qjpA|2e-08|21.7|106/137|f.4.1.1| HM:SCP:REP 43->218|1g90A_|4.2e-26|32.9|164/0|f.4.1.1|1/1|OMPA-like| OP:NHOMO 193 OP:NHOMOORG 53 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------52242459B5444545544564665665-11-11-1136--42222223322255------------------------------------------------------------1----------------------------------------------------1-------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 51.4 SQ:SECSTR ##########################################################################################################HHHHHTTTcEEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEEEEEcEEEEEEEEEEEEEEEEEEEEEETTEEEEEEEEEEEEccccEEEEEcTTccEEEEEEcTTcTTHHH DISOP:02AL 218-219| PSIPRED cHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEEEEEEcccccccccccccccEEEEEEEEEEEEEccEEEEEEEEEEEccccccccEEccccccEEEEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEEcccccccccccEEEEEEEEEEEEEcccEEEEEEEEEEEccccEEEEcccEEEEcccEEEEEEEEEEEc //