[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ros
DDBJ      :ros          transcriptional regulator
Swiss-Prot:ROS_RHIRD    RecName: Full=Transcriptional regulatory protein ros;

Homologs  Archaea  0/68 : Bacteria  104/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:142 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   56->142 2jspA PDBj 4e-48 98.9 %
:RPS:PDB   79->112 2an6A PDBj 3e-04 8.8 %
:RPS:PFM   13->136 PF05443 * ROS_MUCR 3e-34 66.7 %
:HMM:PFM   10->136 PF05443 * ROS_MUCR 6.9e-58 62.2 127/132  
:BLT:SWISS 1->142 ROS_RHIRD 6e-79 99.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86720.1 GT:GENE ros GT:PRODUCT transcriptional regulator GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 905301..905729 GB:FROM 905301 GB:TO 905729 GB:DIRECTION + GB:GENE ros GB:PRODUCT transcriptional regulator GB:PROTEIN_ID AAK86720.1 GB:DB_XREF GI:15155910 GB:GENE:GENE ros LENGTH 142 SQ:AASEQ MTETAYGNAQDLLVELTADIVAAYVSNHVVPVTELPGLISDVHTALSGTSAPASVAVNVEKQKPAVSVRKSVQDDHIVCLECGGSFKSLKRHLTTHHSMTPEEYREKWDLPVDYPMVAPAYAEARSRLAKEMGLGQRRKASR GT:EXON 1|1-142:0| SW:ID ROS_RHIRD SW:DE RecName: Full=Transcriptional regulatory protein ros; SW:GN Name=ros; SW:KW 3D-structure; DNA-binding; Metal-binding; Repressor; Transcription;Transcription regulation; Zinc; Zinc-finger. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->142|ROS_RHIRD|6e-79|99.3|142/142| GO:SWS:NREP 4 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| BL:PDB:NREP 1 BL:PDB:REP 56->142|2jspA|4e-48|98.9|87/87| RP:PDB:NREP 1 RP:PDB:REP 79->112|2an6A|3e-04|8.8|34/191| RP:PFM:NREP 1 RP:PFM:REP 13->136|PF05443|3e-34|66.7|123/127|ROS_MUCR| HM:PFM:NREP 1 HM:PFM:REP 10->136|PF05443|6.9e-58|62.2|127/132|ROS_MUCR| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF05443|IPR008807| GO:PFM GO:0008270|"GO:zinc ion binding"|PF05443|IPR008807| GO:PFM GO:0045449|"GO:regulation of transcription"|PF05443|IPR008807| OP:NHOMO 323 OP:NHOMOORG 104 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------333211111111111111111111111111111-F7UA9i6P192131111131115333221----------1111111115443822------------------------------12611------------------------------------------------------------------------1---33113133313-4211112-------3---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 87 STR:RPRED 61.3 SQ:SECSTR #######################################################ccccccccccccccTTcccccEETTTccHHHHccEEEEHHHHHHHEETTEEEEEEEEGcccccTTTTTTTTTccccccccccccccc DISOP:02AL 1-7, 51-62, 125-135, 137-142| PSIPRED ccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHcccccEEEEEEcccccHHHHHHHHHcccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccccc //