[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : rph
DDBJ      :rph          ribonuclease PH
Swiss-Prot:RNPH_AGRT5   RecName: Full=Ribonuclease PH;         Short=RNase PH;         EC=2.7.7.56;AltName: Full=tRNA nucleotidyltransferase;

Homologs  Archaea  25/68 : Bacteria  598/915 : Eukaryota  24/199 : Viruses  0/175   --->[See Alignment]
d.101.1d.14.1
:238 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->238 1r6mA PDBj 2e-75 61.4 %
:RPS:PDB   2->238 3b4tC PDBj 1e-66 49.6 %
:RPS:SCOP  1->151 1oypA1  d.14.1.4 * 2e-39 59.0 %
:RPS:SCOP  156->238 2ba0D2  d.101.1.1 * 1e-20 25.3 %
:HMM:SCOP  1->140 1oysA1 d.14.1.4 * 1.2e-44 38.6 %
:HMM:SCOP  153->237 1oysA2 d.101.1.1 * 4.4e-21 41.2 %
:RPS:PFM   10->139 PF01138 * RNase_PH 1e-17 40.5 %
:RPS:PFM   160->223 PF03725 * RNase_PH_C 5e-05 38.1 %
:HMM:PFM   10->139 PF01138 * RNase_PH 2.7e-28 29.4 126/132  
:HMM:PFM   159->225 PF03725 * RNase_PH_C 6.7e-13 23.9 67/68  
:BLT:SWISS 1->238 RNPH_AGRT5 e-136 100.0 %
:PROS 116->128|PS01277|RIBONUCLEASE_PH

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86144.2 GT:GENE rph GT:PRODUCT ribonuclease PH GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(321046..321762) GB:FROM 321046 GB:TO 321762 GB:DIRECTION - GB:GENE rph GB:PRODUCT ribonuclease PH GB:PROTEIN_ID AAK86144.2 GB:DB_XREF GI:159139588 GB:GENE:GENE rph LENGTH 238 SQ:AASEQ MRPSGRKTDQMRKVSFERNFSKHAEGSCLVKFGDTHVLVTASLEEKTPPWLRNSGKGWVTAEYGMLPRSTNERMKREAASGKQGGRTQEIQRLIGRSLRAVVDLQALGERQISIDCDVIQADGGTRTASITGAWIALHDCLKWMETRNMIKVEKVLKDHIAAISCGIFAKQPVIDLDYLEDSSAETDANFVITGSGGIVEVQGTAEGAPFSEEEFLTLLGLAKAGCSELVALQKQAIA GT:EXON 1|1-238:0| SW:ID RNPH_AGRT5 SW:DE RecName: Full=Ribonuclease PH; Short=RNase PH; EC=2.7.7.56;AltName: Full=tRNA nucleotidyltransferase; SW:GN Name=rph; OrderedLocusNames=Atu0327; ORFNames=AGR_C_571; SW:KW Complete proteome; Nucleotidyltransferase; Transferase;tRNA processing. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->238|RNPH_AGRT5|e-136|100.0|238/238| GO:SWS:NREP 3 GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| PROS 116->128|PS01277|RIBONUCLEASE_PH|PDOC00983| BL:PDB:NREP 1 BL:PDB:REP 2->238|1r6mA|2e-75|61.4|233/236| RP:PDB:NREP 1 RP:PDB:REP 2->238|3b4tC|1e-66|49.6|232/241| RP:PFM:NREP 2 RP:PFM:REP 10->139|PF01138|1e-17|40.5|126/130|RNase_PH| RP:PFM:REP 160->223|PF03725|5e-05|38.1|63/68|RNase_PH_C| HM:PFM:NREP 2 HM:PFM:REP 10->139|PF01138|2.7e-28|29.4|126/132|RNase_PH| HM:PFM:REP 159->225|PF03725|6.7e-13|23.9|67/68|RNase_PH_C| GO:PFM:NREP 6 GO:PFM GO:0000175|"GO:3'-5'-exoribonuclease activity"|PF01138|IPR001247| GO:PFM GO:0003723|"GO:RNA binding"|PF01138|IPR001247| GO:PFM GO:0006396|"GO:RNA processing"|PF01138|IPR001247| GO:PFM GO:0000175|"GO:3'-5'-exoribonuclease activity"|PF03725|IPR015847| GO:PFM GO:0003723|"GO:RNA binding"|PF03725|IPR015847| GO:PFM GO:0006396|"GO:RNA processing"|PF03725|IPR015847| RP:SCP:NREP 2 RP:SCP:REP 1->151|1oypA1|2e-39|59.0|134/134|d.14.1.4| RP:SCP:REP 156->238|2ba0D2|1e-20|25.3|83/99|d.101.1.1| HM:SCP:REP 1->140|1oysA1|1.2e-44|38.6|140/151|d.14.1.4|1/1|Ribosomal protein S5 domain 2-like| HM:SCP:REP 153->237|1oysA2|4.4e-21|41.2|85/86|d.101.1.1|1/1|Ribonuclease PH domain 2-like| OP:NHOMO 652 OP:NHOMOORG 647 OP:PATTERN ------12-------211-----1--------111-------------11-1111111111111---1 1111111111111111111-1111111111111111111111111111-1111111111111111111111-1111111--1-11111------------------------------------------------11111111-11111---111111111-1-1-1111-1-----1----111--11--11111111111111111111111111111111111111111--------------------1---------------------------------------------------------------------111---------1-11111-111--1--1--1111111111111111-111111111-----111111111111111111111111-1111111111111111111111111111111111111111111111111111111----------111111111111111-----11111111111111111111111111111111111111-111111111--111-11111111111111111111111---1----------1111111111111111--------------------------11111111111111111111111111111111--11111------11111111111-11111-11-1111111111111111111111111111111111111111111111111-111111111111--111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111--1------------------------------------------------------11 ----11--------1-----------------------------------------------1-----------------------1----------------11--1-12-----1---------------------------------------------1-111--21111-----------1--1-1---1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 238 STR:RPRED 100.0 SQ:SECSTR ccTTcccTTccccEEEEETccccccEEEEEEETTEEEEEEEEEEEcccccGTTccccEEEEEEEEcGGGcccccccHHHHTcccHHHHHHHHHHHHHHHTTccTTTTccEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHTcccccccccccEEEEEEEEETTEEEEcccHHHHHHEEEEEEEEEETTccEEEEEcccTTccccHHHHHHHHHHHHHHHHHHHHHHHHHHT DISOP:02AL 71-86| PSIPRED cccccccHHHEEEEEEEEcccccccEEEEEEEcccEEEEEEEcccccccHHcccccEEEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHcccEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEEccEEEEEccHHHHHHccccEEEEEcccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHc //