[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : rpsB
DDBJ      :rpsB         30S ribosomal protein S2
Swiss-Prot:RS2_AGRT5    RecName: Full=30S ribosomal protein S2;

Homologs  Archaea  0/68 : Bacteria  909/915 : Eukaryota  147/199 : Viruses  0/175   --->[See Alignment]
c.23.15
:255 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->225 2gy9B PDBj 1e-63 52.1 %
:RPS:PDB   5->236 3bbnB PDBj 2e-70 37.7 %
:RPS:SCOP  8->252 1fjgB  c.23.15.1 * 1e-83 43.0 %
:HMM:SCOP  8->243 1fjgB_ c.23.15.1 * 7.9e-93 53.4 %
:RPS:PFM   11->224 PF00318 * Ribosomal_S2 1e-72 57.8 %
:HMM:PFM   11->224 PF00318 * Ribosomal_S2 1.2e-90 55.5 209/211  
:BLT:SWISS 1->255 RS2_AGRT5 e-135 100.0 %
:PROS 8->19|PS00962|RIBOSOMAL_S2_1
:PROS 159->183|PS00963|RIBOSOMAL_S2_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87166.2 GT:GENE rpsB GT:PRODUCT 30S ribosomal protein S2 GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1368005..1368772 GB:FROM 1368005 GB:TO 1368772 GB:DIRECTION + GB:GENE rpsB GB:PRODUCT 30S ribosomal protein S2 GB:PROTEIN_ID AAK87166.2 GB:DB_XREF GI:159140024 GB:GENE:GENE rpsB LENGTH 255 SQ:AASEQ MALPDFSMRQLLEAGVHFGHQTHRWNPKMKPYIFGDRNNIHIIDLAQTVPMLSRALQVVSDTVARGGRVLFVGTKRQASEIIADSAKRSAQYYVNSRWLGGMMTNWKTISNSIQRLRKVDEILNSEGSGYSKKERLTLEREREKLEKALGGIRDMGGVPDLMFIIDTNKEKIAIEEAKRLGIPVVAIIDSNCDPDHIDYPIPGNDDASRAISLYCDLIARAAIDGIARQQGASGRDIGASEEAPIEPALEDEAGA GT:EXON 1|1-255:0| SW:ID RS2_AGRT5 SW:DE RecName: Full=30S ribosomal protein S2; SW:GN Name=rpsB; OrderedLocusNames=Atu1374; ORFNames=AGR_C_2539; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->255|RS2_AGRT5|e-135|100.0|255/255| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 8->19|PS00962|RIBOSOMAL_S2_1|PDOC00744| PROS 159->183|PS00963|RIBOSOMAL_S2_2|PDOC00744| SEG 132->147|kkerltlerereklek| BL:PDB:NREP 1 BL:PDB:REP 8->225|2gy9B|1e-63|52.1|217/236| RP:PDB:NREP 1 RP:PDB:REP 5->236|3bbnB|2e-70|37.7|228/231| RP:PFM:NREP 1 RP:PFM:REP 11->224|PF00318|1e-72|57.8|211/212|Ribosomal_S2| HM:PFM:NREP 1 HM:PFM:REP 11->224|PF00318|1.2e-90|55.5|209/211|Ribosomal_S2| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00318|IPR001865| GO:PFM GO:0005622|"GO:intracellular"|PF00318|IPR001865| GO:PFM GO:0005840|"GO:ribosome"|PF00318|IPR001865| GO:PFM GO:0006412|"GO:translation"|PF00318|IPR001865| RP:SCP:NREP 1 RP:SCP:REP 8->252|1fjgB|1e-83|43.0|235/237|c.23.15.1| HM:SCP:REP 8->243|1fjgB_|7.9e-93|53.4|236/0|c.23.15.1|1/1|Ribosomal protein S2| OP:NHOMO 1076 OP:NHOMOORG 1056 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ------1-----11111111111111111111111111111111111111111111111-1111111111111111111111111111-11-1111---111-111-12-211112--11-11111141371-1121-1-1-111-11----11111-11121111-111-11112---------111-1-1------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 252 STR:RPRED 98.8 SQ:SECSTR ##ccccccHHHHHTccccccccccccGGGGGGEEEEETTEEEEcHHHHHHHTHHHHHHcHHHHTTTccEEEEcccTTTHHHHHHHHHHHTcEEccccccccccccHHHHHHHHHHHHHHHHcTTcTTTTccHHHHHHHHHHHHHHTTcTTcTTcccccccEEEEccTTTTHHHHHHHHTTTccEEEccccccccccccEEcccccccHHHHHHHHHHHHHHHHHTHTcccccccccccGGGccc#ccccccTTcT DISOP:02AL 1-1,229-238,240-242,244-256| PSIPRED ccccHHHHHHHHHcccccccccccccccHHHHccEEEccEEEEEHHHHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHcccEEcccccccHHHcHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHccccEEEEEccccccccccEEccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHcccccccHHHccc //