[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : rrf
DDBJ      :rrf          ribosome recycling factor
Swiss-Prot:RRF_AGRT5    RecName: Full=Ribosome-recycling factor;         Short=RRF;AltName: Full=Ribosome-releasing factor;

Homologs  Archaea  0/68 : Bacteria  907/915 : Eukaryota  90/199 : Viruses  0/175   --->[See Alignment]
d.67.3
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->184 1iseA PDBj 1e-44 46.3 %
:RPS:PDB   1->184 1ek8A PDBj 1e-63 45.7 %
:RPS:SCOP  6->184 1dd5A  d.67.3.1 * 2e-63 35.8 %
:HMM:SCOP  1->185 1is1A_ d.67.3.1 * 1.3e-66 48.1 %
:RPS:PFM   19->183 PF01765 * RRF 2e-38 51.5 %
:HMM:PFM   19->183 PF01765 * RRF 2.7e-67 50.3 165/165  
:BLT:SWISS 1->185 RRF_AGRT5 e-102 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87169.1 GT:GENE rrf GT:PRODUCT ribosome recycling factor GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1370945..1371502 GB:FROM 1370945 GB:TO 1371502 GB:DIRECTION + GB:GENE rrf GB:PRODUCT ribosome recycling factor GB:PROTEIN_ID AAK87169.1 GB:DB_XREF GI:15156443 GB:GENE:GENE rrf LENGTH 185 SQ:AASEQ MSGIDLNDIKRRMDGAINAFKSDIASLRTGRASANILDPVTIDAYGSRVPLNQVANITVPEPRMLGVNIWDKSMVNAVDRAIRESNLGLNPIVDGQNLRIPLPELNEERRKSLVKVAHEYSEKAKVAIRHVRRDGMDGLKKAEKDGDIGQDESRGQSEKVQKMTDDTISEIDRLLAEKEKEIMQV GT:EXON 1|1-185:0| SW:ID RRF_AGRT5 SW:DE RecName: Full=Ribosome-recycling factor; Short=RRF;AltName: Full=Ribosome-releasing factor; SW:GN Name=frr; Synonyms=rrf; OrderedLocusNames=Atu1377;ORFNames=AGR_C_2546; SW:KW Complete proteome; Cytoplasm; Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->185|RRF_AGRT5|e-102|100.0|185/185| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 8->184|1iseA|1e-44|46.3|177/184| RP:PDB:NREP 1 RP:PDB:REP 1->184|1ek8A|1e-63|45.7|184/185| RP:PFM:NREP 1 RP:PFM:REP 19->183|PF01765|2e-38|51.5|165/165|RRF| HM:PFM:NREP 1 HM:PFM:REP 19->183|PF01765|2.7e-67|50.3|165/165|RRF| GO:PFM:NREP 1 GO:PFM GO:0006412|"GO:translation"|PF01765|IPR002661| RP:SCP:NREP 1 RP:SCP:REP 6->184|1dd5A|2e-63|35.8|179/184|d.67.3.1| HM:SCP:REP 1->185|1is1A_|1.3e-66|48.1|185/185|d.67.3.1|1/1|Ribosome recycling factor, RRF| OP:NHOMO 1044 OP:NHOMOORG 997 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ----111-----111---------------------------------------------------------1----------------11---1-11111-1111-141211-1111-1111111-2-652-222-1111-111-1---1--1111-1---11111111---1122229222212222-214222111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 185 STR:RPRED 100.0 SQ:SECSTR cHHHHHHHHHHHHHHHHHHHHHHHHTcccccccTTTTTTcEEEETTEEEEGGGTEEEEEEETTEEEEEEccGGGHHHHHHHHHHTccccccEEETTEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTc DISOP:02AL 185-186| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHccEEEEEccccEEEEEEEEEEcccccEEEEEEccHHHHHHHHHHHHHccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //