[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : sdhC
DDBJ      :sdhC         succinate dehydrogenase cytochrome B-556 subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  200/915 : Eukaryota  29/199 : Viruses  0/175   --->[See Alignment]
f.21.2
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->126 1nekC PDBj 1e-13 31.7 %
:RPS:SCOP  1->126 1nekC  f.21.2.2 * 6e-26 30.2 %
:HMM:SCOP  2->127 1nekC_ f.21.2.2 * 4.4e-31 35.7 %
:RPS:PFM   7->98 PF01127 * Sdh_cyt 5e-12 44.6 %
:HMM:PFM   5->121 PF01127 * Sdh_cyt 4.2e-30 38.3 115/121  
:BLT:SWISS 1->128 DHSC_PARDE 1e-24 39.1 %
:PROS 8->32|PS01000|SDH_CYT_1
:PROS 83->96|PS01001|SDH_CYT_2
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88367.2 GT:GENE sdhC GT:PRODUCT succinate dehydrogenase cytochrome B-556 subunit GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2630977..2631369) GB:FROM 2630977 GB:TO 2631369 GB:DIRECTION - GB:GENE sdhC GB:PRODUCT succinate dehydrogenase cytochrome B-556 subunit GB:PROTEIN_ID AAK88367.2 GB:DB_XREF GI:159140565 GB:GENE:GENE sdhC LENGTH 130 SQ:AASEQ MANVTNNRPLSPHLQIYKPIPTMVASIVHRITGGALYFGTLLVAWWLIALASGPAYYDWVNWAMGTIIGRLILIGYTWALVHHMLGGLRHFMWDLGHGFDKHFTTKLAKASWVASICLTALIWVIVLIVR GT:EXON 1|1-130:0| BL:SWS:NREP 1 BL:SWS:REP 1->128|DHSC_PARDE|1e-24|39.1|128/130| PROS 8->32|PS01000|SDH_CYT_1|PDOC00767| PROS 83->96|PS01001|SDH_CYT_2|PDOC00767| TM:NTM 3 TM:REGION 35->57| TM:REGION 65->87| TM:REGION 108->130| BL:PDB:NREP 1 BL:PDB:REP 3->126|1nekC|1e-13|31.7|123/129| RP:PFM:NREP 1 RP:PFM:REP 7->98|PF01127|5e-12|44.6|92/120|Sdh_cyt| HM:PFM:NREP 1 HM:PFM:REP 5->121|PF01127|4.2e-30|38.3|115/121|Sdh_cyt| GO:PFM:NREP 1 GO:PFM GO:0016627|"GO:oxidoreductase activity, acting on the CH-CH group of donors"|PF01127|IPR000701| RP:SCP:NREP 1 RP:SCP:REP 1->126|1nekC|6e-26|30.2|126/129|f.21.2.2| HM:SCP:REP 2->127|1nekC_|4.4e-31|35.7|126/129|f.21.2.2|1/1|Fumarate reductase respiratory complex transmembrane subunits| OP:NHOMO 234 OP:NHOMOORG 229 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111-11111111111111111111111111111111111111111111111111-1111--111111--111111111111111-1--11111------------------------------------------------------------------1----------------------------------------------------------------11--1---11--1111-1-1111-1--1------11-------1------1111111111-1111111111111111111-11-----1111111111111111-1111111----------------1----------1------------------------------------------------------------------------111111111111-1----------------------------------------------------------- --------------------1111-1----1----------------------------------------------------------------------------1--22---2--11----1--1-131---1------11-1111--------1-1---11---------1------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 95.4 SQ:SECSTR ##TccccccccccGGGccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccccHHHHHHHHHHHHHHHHHHHHHHHH#### DISOP:02AL 1-5| PSIPRED cccHHHcccccccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //