[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : serA.1
DDBJ      :serA         phosphoglycerate dehydrogenase
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  784/915 : Eukaryota  185/199 : Viruses  0/175   --->[See Alignment]
c.2.1c.23.12
:328 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   73->316 1wwkA PDBj 6e-27 32.0 %
:RPS:PDB   19->323 3ba1A PDBj 2e-58 25.9 %
:RPS:SCOP  24->125 1psdA2  c.23.12.1 * 6e-08 20.6 %
:RPS:SCOP  99->294 1hkuA1  c.2.1.4 * 9e-37 27.5 %
:HMM:SCOP  1->135 1ygyA2 c.23.12.1 * 2e-05 28.0 %
:HMM:SCOP  96->294 1gdhA1 c.2.1.4 * 5.8e-50 41.1 %
:RPS:PFM   109->292 PF02826 * 2-Hacid_dh_C 4e-32 42.6 %
:HMM:PFM   107->292 PF02826 * 2-Hacid_dh_C 1.5e-56 40.3 176/178  
:BLT:SWISS 36->323 SERA_METJA 3e-31 36.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87192.1 GT:GENE serA.1 GT:PRODUCT phosphoglycerate dehydrogenase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1394282..1395268) GB:FROM 1394282 GB:TO 1395268 GB:DIRECTION - GB:GENE serA GB:PRODUCT phosphoglycerate dehydrogenase GB:PROTEIN_ID AAK87192.1 GB:DB_XREF GI:15156468 GB:GENE:GENE serA LENGTH 328 SQ:AASEQ MSKRIVFHGENAACFSDDFKNLVEGGAEIALLPDQLVTEEDRNAYRKADIIVGVKFDASLPTPERLTLFHVPGAGYDAVNLDLLPKSAVVCNCFGHDPAIAEYVFSAILNRHVPLRDADNKLRAGQWAYWSGSTERLHDEMSGKTIGLLGFGHIGKAIAVRAKAFGMQVSVANRSRVETSDLVDRSFTLDQLNEFWPTADFIVVSVPLTDTTRGIVDAEAFAAMKSGAVIINVGRGPTIDEQALYDALKSGTIGGAVIDTWYAYPSPDAPTRQPSALPFNQLENIIMTPHMSGWTSGTVRRRQQTIAENINRRLKGQDCINIVRTASE GT:EXON 1|1-328:0| BL:SWS:NREP 1 BL:SWS:REP 36->323|SERA_METJA|3e-31|36.5|266/524| BL:PDB:NREP 1 BL:PDB:REP 73->316|1wwkA|6e-27|32.0|231/304| RP:PDB:NREP 1 RP:PDB:REP 19->323|3ba1A|2e-58|25.9|290/312| RP:PFM:NREP 1 RP:PFM:REP 109->292|PF02826|4e-32|42.6|169/176|2-Hacid_dh_C| HM:PFM:NREP 1 HM:PFM:REP 107->292|PF02826|1.5e-56|40.3|176/178|2-Hacid_dh_C| GO:PFM:NREP 2 GO:PFM GO:0016616|"GO:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor"|PF02826|IPR006140| GO:PFM GO:0048037|"GO:cofactor binding"|PF02826|IPR006140| RP:SCP:NREP 2 RP:SCP:REP 24->125|1psdA2|6e-08|20.6|102/132|c.23.12.1| RP:SCP:REP 99->294|1hkuA1|9e-37|27.5|189/193|c.2.1.4| HM:SCP:REP 1->135|1ygyA2|2e-05|28.0|125/0|c.23.12.1|1/1|Formate/glycerate dehydrogenase catalytic domain-like| HM:SCP:REP 96->294|1gdhA1|5.8e-50|41.1|190/191|c.2.1.4|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 4494 OP:NHOMOORG 1036 OP:PATTERN 33211142222222123322311252233361111111222212121112221233333331222-22 237-832333311344422-231149222224344423CC2413423122226A6322--43424676B62322233311323222334433-333---23424444613-----------------1311--12-333541112322124422222111111222233521111112211123223344222333333333233333343543333334448113222232337777776777777766646324444371215544461126962223331----11-----------1----111111-12111111111361574443333233235532224311143241671111321388421334145335-1--167DDC3235978555555554557-6767686BDA4-DDD7A6ADBACGB844154766788462222222244531333-----------------------------1345324865C9AAAB84444488FC666656B6F9CDA-47756478694D4CA54212--22212222244212133321--2311222223233234733332324222222222222121112212233222434462324335444435544434456353--12334------55664434445465634-44456554544644444447C8563345555555555555555955433341-755555555555--1211111333223369222324-33222222223222522293666669CB586983877111113111323336566543555332323322311111113222222--------11-------1---1------1-------3243324222231 ----372-63--3529BB88AB8DAC96767687775B8998A877867CDFKIABB87776E4633324435465535579989B33-7C5B583A9BA716554-383CA999A411-23416D1B4AU7-668142-93253-233151-53B57A22624834E58822863544u35338E9FL89A56GBID4 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 326 STR:RPRED 99.4 SQ:SECSTR cccEEEEcccccHHHHHHHHHHHHHcEEEEGGGcccHHHHHHHHTTTEEEEEEccccHHHHHcTTccEEEEcccccTTccHHHHHHHTcEEEccTTHHHHHHHHHHHHHHHHTTHHHHHHHHHTTGGGGccccccccccccTTccEEEEcccHHHHHHHHHHHTTTccEEEEcccccTTcccEHTTcEEccHHHHHHTccEEEEcccccGGGTTcccHHHHHHHcTTcEEEEcccGGGccHHHHHHHHHHTcccEEEEcccTTTTcccGGGGcHHHHGGGGcTTEEEccccTTccHHHHHHHHHHHHHHHHHHHHTccccccccHH## DISOP:02AL 327-328| PSIPRED ccccEEEEcccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHcccEEEEEcccHHHHHcccccEEEEEEccccccccHHHHHHccEEEEcccccHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccccccccccccEEEEEEccHHHHHHHHHHHHcccEEEEEcccccccHHHHHcccccccHHHHHHHccEEEEEccccHHHHHHccHHHHHHccccEEEEEccccccccHHHHHHHHHcccEEEEEEEcccccccccccccHHHHHHHHccccEEEccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccc //