[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : serS
DDBJ      :serS         seryl-tRNA synthetase
Swiss-Prot:SYS_AGRT5    RecName: Full=Seryl-tRNA synthetase;         EC=6.1.1.11;AltName: Full=Seryl-tRNA(Ser/Sec) synthetase;AltName: Full=Serine--tRNA ligase;         Short=SerRS;

Homologs  Archaea  55/68 : Bacteria  911/915 : Eukaryota  194/199 : Viruses  0/175   --->[See Alignment]
a.2.7c.108.1d.104.1
:427 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->418 2dq3A PDBj e-103 52.4 %
:RPS:PDB   1->423 2dq0A PDBj e-109 38.6 %
:RPS:SCOP  10->80 1qyiA  c.108.1.13 * 4e-04 26.8 %
:RPS:SCOP  118->420 1serA2  d.104.1.1 * 7e-58 38.3 %
:HMM:SCOP  1->114 1setA1 a.2.7.1 * 6.6e-33 44.5 %
:HMM:SCOP  118->424 1setA2 d.104.1.1 * 1.3e-92 44.4 %
:RPS:PFM   1->108 PF02403 * Seryl_tRNA_N 1e-10 39.6 %
:RPS:PFM   174->338 PF00587 * tRNA-synt_2b 6e-16 33.1 %
:HMM:PFM   174->343 PF00587 * tRNA-synt_2b 2.7e-37 27.1 166/173  
:HMM:PFM   1->109 PF02403 * Seryl_tRNA_N 2.1e-32 44.9 107/108  
:BLT:SWISS 1->427 SYS_AGRT5 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87476.2 GT:GENE serS GT:PRODUCT seryl-tRNA synthetase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1688355..1689638) GB:FROM 1688355 GB:TO 1689638 GB:DIRECTION - GB:GENE serS GB:PRODUCT seryl-tRNA synthetase GB:PROTEIN_ID AAK87476.2 GB:DB_XREF GI:159140158 GB:GENE:GENE serS LENGTH 427 SQ:AASEQ MHDIKWIRENPEAFDAALARRSVEPAAAGLIALDEKRRSVIQSLQDMQSRRNAASKEIGAAMAQKNMELAEKLKAEVADIKENMPRAEEEDRQVSAELNDALSRLPNMPFDDVPDGKDEHDNVVARVTGQKPGWNHAAKEHFEIGEALGYMDFERAAKLSGSRFTVLTSQLARLERALGQFMIDLHTSEHGYTEVSSPLMVRDEAMFGTGQLPKFAEDLFRTTDGRWLIPTAEVTLTNLVSGEILEQEKLPLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDAESAVAEHERMTACAEEVLKRLGLHFRTLTLCTGDMGFSARKTYDLEVWLPGQNTYREISSCSVCGDFQARRMNARYRGKDDKATKFVHTLNGSGTAVGRCLIAVLENYLNDDGSVTIPDVLLPYMGGLTRIEKAA GT:EXON 1|1-427:0| SW:ID SYS_AGRT5 SW:DE RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.11;AltName: Full=Seryl-tRNA(Ser/Sec) synthetase;AltName: Full=Serine--tRNA ligase; Short=SerRS; SW:GN Name=serS; OrderedLocusNames=Atu1703; ORFNames=AGR_C_3129; SW:KW Aminoacyl-tRNA synthetase; ATP-binding; Complete proteome; Cytoplasm;Ligase; Nucleotide-binding; Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->427|SYS_AGRT5|0.0|100.0|427/427| GO:SWS:NREP 6 GO:SWS GO:0004812|"GO:aminoacyl-tRNA ligase activity"|Aminoacyl-tRNA synthetase| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 3->418|2dq3A|e-103|52.4|401/422| RP:PDB:NREP 1 RP:PDB:REP 1->423|2dq0A|e-109|38.6|420/447| RP:PFM:NREP 2 RP:PFM:REP 1->108|PF02403|1e-10|39.6|106/107|Seryl_tRNA_N| RP:PFM:REP 174->338|PF00587|6e-16|33.1|160/170|tRNA-synt_2b| HM:PFM:NREP 2 HM:PFM:REP 174->343|PF00587|2.7e-37|27.1|166/173|tRNA-synt_2b| HM:PFM:REP 1->109|PF02403|2.1e-32|44.9|107/108|Seryl_tRNA_N| GO:PFM:NREP 12 GO:PFM GO:0000166|"GO:nucleotide binding"|PF02403|IPR015866| GO:PFM GO:0004828|"GO:serine-tRNA ligase activity"|PF02403|IPR015866| GO:PFM GO:0005524|"GO:ATP binding"|PF02403|IPR015866| GO:PFM GO:0005737|"GO:cytoplasm"|PF02403|IPR015866| GO:PFM GO:0006412|"GO:translation"|PF02403|IPR015866| GO:PFM GO:0006434|"GO:seryl-tRNA aminoacylation"|PF02403|IPR015866| GO:PFM GO:0000166|"GO:nucleotide binding"|PF00587|IPR002314| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF00587|IPR002314| GO:PFM GO:0005524|"GO:ATP binding"|PF00587|IPR002314| GO:PFM GO:0005737|"GO:cytoplasm"|PF00587|IPR002314| GO:PFM GO:0006412|"GO:translation"|PF00587|IPR002314| GO:PFM GO:0006418|"GO:tRNA aminoacylation for protein translation"|PF00587|IPR002314| RP:SCP:NREP 2 RP:SCP:REP 10->80|1qyiA|4e-04|26.8|71/380|c.108.1.13| RP:SCP:REP 118->420|1serA2|7e-58|38.3|300/311|d.104.1.1| HM:SCP:REP 1->114|1setA1|6.6e-33|44.5|110/110|a.2.7.1|1/1|tRNA-binding arm| HM:SCP:REP 118->424|1setA2|1.3e-92|44.4|304/0|d.104.1.1|1/1|Class II aaRS and biotin synthetases| OP:NHOMO 1516 OP:NHOMOORG 1160 OP:PATTERN 1111111111111111111111111111111111---------1-111--111-11111111111111 1111111111111111111-11111111111111111111111211111111111111111111111211111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111221111111211111111111111211111111111111111111211111111112211111111111111111111111111111111111111111111111111111111111121222222212112111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111212111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111122112212222222222-22222222122222222222122211122222222222222221222222211211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111-11111111111111111111111111111111 2111222141112232222222222222222222222222222222323323332222222222222212222222222122222222-24222222222222334122263224312122-2244-225M2-3351122322311221122132111322423221221-22122222N2222243742422242222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 427 STR:RPRED 100.0 SQ:SECSTR cccHHHHHHcHHHHHHHHHHHTcGGGTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccEEccTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccTTccccccGGGcEEEEEEccEEEEGGGcccHHHHHHHTTcEEcHHHHHHTcTTccEEcHHHHHHHHHHHHHHHHHHHHHTTcEEEccccEEcHHHHHTTccTTHHHHTccccTTccEEcccTHHHHHHTTTTEEEETTTccEEEEEEEEEEcccTTcccccccccccccEEEEEEEEEEEcTTTHHHHHHHHHHHHHHHHHHTTccEEEEEccGGGccccccEEEEEEEEETTTTEEEEEEEEEEcTTTTHHHHTEEEEccTTcccEEcEEEEEEEEEHHHHHHHHHHHcccTTccEEccGGGHHHHcccEEcccEE DISOP:02AL 51-75,368-372,425-428| PSIPRED cccHHHHHccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEccccccccccccHHHHHHHccccccccHHHccccccEEEccHHHHHHHHHHHHHHHHHHHHcccEEEccccEEcHHHHHHccccccccHHEEEEEcccEEccccHHHHHHHHHcccccHHHccEEEEEEEEEEccccccccccccccEEEHEEEEEccEEEEcHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccEEEEEEEEEcccccEEEEEEcccHHHHHHHHccccccccccccEEEEEEEcccccHHHHHHHHHHHHHccccccEEccHHHcccccccccccccc //