[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : sigK
DDBJ      :sigK         sigma factor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  337/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
a.177.1a.4.13
:180 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->178 2q1zA PDBj 5e-19 34.0 %
:RPS:PDB   5->180 3dxjF PDBj 1e-18 11.4 %
:RPS:SCOP  5->91 1iw7F3  a.177.1.1 * 3e-12 13.8 %
:RPS:SCOP  92->180 1iw7F2  a.4.13.2 * 2e-06 18.2 %
:HMM:SCOP  1->112 1or7A2 a.177.1.1 * 6.6e-22 30.9 %
:HMM:SCOP  110->180 1rp3A2 a.4.13.2 * 7.4e-11 28.2 %
:RPS:PFM   30->91 PF04542 * Sigma70_r2 2e-06 35.5 %
:HMM:PFM   24->91 PF04542 * Sigma70_r2 6.4e-19 27.9 68/71  
:HMM:PFM   122->174 PF08281 * Sigma70_r4_2 2.6e-12 30.2 53/54  
:BLT:SWISS 4->178 SIGK_MYCSS 4e-29 33.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87740.2 GT:GENE sigK GT:PRODUCT sigma factor GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1947933..1948475 GB:FROM 1947933 GB:TO 1948475 GB:DIRECTION + GB:GENE sigK GB:PRODUCT sigma factor GB:PROTEIN_ID AAK87740.2 GB:DB_XREF GI:159140274 GB:GENE:GENE sigK LENGTH 180 SQ:AASEQ MQGTEIATLINRVGMGDRSAFVSLYQATSPKLFAICLKILRDRTEAEEALQEIYIKVWQRARTFAVSAGKPATWLATIARNHAIDTIRARKPASDDIDEAYDLVDESIRDPEQQVVLVDEGRRIDDCMRELETVHAQAVRRAYVEGLSYLELSDELRVPLNTVRTWLRRSLLKLRECMQR GT:EXON 1|1-180:0| BL:SWS:NREP 1 BL:SWS:REP 4->178|SIGK_MYCSS|4e-29|33.9|174/193| BL:PDB:NREP 1 BL:PDB:REP 17->178|2q1zA|5e-19|34.0|156/176| RP:PDB:NREP 1 RP:PDB:REP 5->180|3dxjF|1e-18|11.4|176/349| RP:PFM:NREP 1 RP:PFM:REP 30->91|PF04542|2e-06|35.5|62/70|Sigma70_r2| HM:PFM:NREP 2 HM:PFM:REP 24->91|PF04542|6.4e-19|27.9|68/71|Sigma70_r2| HM:PFM:REP 122->174|PF08281|2.6e-12|30.2|53/54|Sigma70_r4_2| GO:PFM:NREP 5 GO:PFM GO:0003677|"GO:DNA binding"|PF04542|IPR007627| GO:PFM GO:0003700|"GO:transcription factor activity"|PF04542|IPR007627| GO:PFM GO:0006352|"GO:transcription initiation"|PF04542|IPR007627| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF04542|IPR007627| GO:PFM GO:0016987|"GO:sigma factor activity"|PF04542|IPR007627| RP:SCP:NREP 2 RP:SCP:REP 5->91|1iw7F3|3e-12|13.8|87/184|a.177.1.1| RP:SCP:REP 92->180|1iw7F2|2e-06|18.2|88/100|a.4.13.2| HM:SCP:REP 1->112|1or7A2|6.6e-22|30.9|110/113|a.177.1.1|1/1|Sigma2 domain of RNA polymerase sigma factors| HM:SCP:REP 110->180|1rp3A2|7.4e-11|28.2|71/0|a.4.13.2|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 660 OP:NHOMOORG 340 OP:PATTERN -------------------------------------------------------------------- 4362412111131-11111-12--1111111132225134-1-221---212122--1----2-1-2134-----1----1-2-----2211-511---1-3144B3917--------------------------44454---332--1---21---------1-4-1--------------3-----2-212---------------122232--12111222------54---------------------------------------------------------------------------------------------------------2---------2--5----112-1-13----1-1--4-11112------156632243543----------1-12111111-52-2334431323-1332-232-2122222--------1-----11------------------------------2-1--1222111111121111222-1111112321211--3311211122112-2311212----------1-21-1-----1-----------------333331-2---------------------------111213231412112214233322321224---1111-----------------------------------------------------------------------------1--------------3----------1412---1-1-1111--------------1111111334121222212-----------11-11111211112222222111------1---2222----------1---------------------------1--------31 ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 176 STR:RPRED 97.8 SQ:SECSTR ####HHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHGGGccccccHHHHHHHHHHHHHHHHHcccTTcccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcTTccHHHHHHHHHHTcccccTTcccTTcccccGGGTccccccccHHHHHHH DISOP:02AL 1-2,180-181| PSIPRED cccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcc //