[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : slyA
DDBJ      :slyA         transcriptional regulator, MarR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  221/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:151 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   52->143 2fbhA PDBj 1e-16 39.1 %
:RPS:PDB   7->142 2a61A PDBj 2e-13 18.4 %
:RPS:SCOP  49->141 2ethA1  a.4.5.28 * 2e-16 29.0 %
:HMM:SCOP  1->140 1jgsA_ a.4.5.28 * 5.7e-30 32.8 %
:RPS:PFM   49->91 PF01047 * MarR 2e-05 51.2 %
:HMM:PFM   34->91 PF01047 * MarR 5.4e-19 43.1 58/59  
:BLT:SWISS 52->146 SLYA_SHIFL 4e-15 40.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86894.2 GT:GENE slyA GT:PRODUCT transcriptional regulator, MarR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1076483..1076938 GB:FROM 1076483 GB:TO 1076938 GB:DIRECTION + GB:GENE slyA GB:PRODUCT transcriptional regulator, MarR family GB:PROTEIN_ID AAK86894.2 GB:DB_XREF GI:159139908 GB:GENE:GENE slyA LENGTH 151 SQ:AASEQ MSRETDKEQLLDEVSAFTRKLRAFFDARVGESGLTLARARALFALSRRGPLTQTELAEEMEIETPTLVRVLDGMEKQNLIERRSDENDRRAKRIHMTEEGEKTSGTVQAVAKSLRSEITADISSEDLAMALDVMRRLSANLQNLAAGRAQS GT:EXON 1|1-151:0| BL:SWS:NREP 1 BL:SWS:REP 52->146|SLYA_SHIFL|4e-15|40.0|95/144| SEG 34->48|ltlararalfalsrr| BL:PDB:NREP 1 BL:PDB:REP 52->143|2fbhA|1e-16|39.1|92/137| RP:PDB:NREP 1 RP:PDB:REP 7->142|2a61A|2e-13|18.4|136/142| RP:PFM:NREP 1 RP:PFM:REP 49->91|PF01047|2e-05|51.2|43/59|MarR| HM:PFM:NREP 1 HM:PFM:REP 34->91|PF01047|5.4e-19|43.1|58/59|MarR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01047|IPR000835| GO:PFM GO:0005622|"GO:intracellular"|PF01047|IPR000835| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01047|IPR000835| RP:SCP:NREP 1 RP:SCP:REP 49->141|2ethA1|2e-16|29.0|93/140|a.4.5.28| HM:SCP:REP 1->140|1jgsA_|5.7e-30|32.8|137/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 261 OP:NHOMOORG 221 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------1111-------------1-------------------1--------------------------------------------------------------------111111--1-111-1-----------------------1--------------------------------------------------------------------------------------------1---------1-1--11-----1--------21------------------1--------112321-------33233333224--11--111----1221------1121-----1-------11111111-22-11-1-------------------------------11--11112------1--------------1-1---1----------1---1--1-----1-------------------1---1-111--1-11-11----------------------------------1111-13---1-------------------1-1------------12-21111111111111-111111111111111111111111211---1----1111-11111111111111111111111-1-11--1--11111--11--------------------------1-11111112111111222-----------111-----1-1----11111111----------11--------------------------------------1------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 93.4 SQ:SECSTR #####ccHHHHHHHHHHHHHHHHHHHTTHHHHTccHHHHHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcHH##### DISOP:02AL 1-3,142-152| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccc //