[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : smpB
DDBJ      :smpB         SSRA-binding protein
Swiss-Prot:SSRP_AGRT5   RecName: Full=SsrA-binding protein;

Homologs  Archaea  0/68 : Bacteria  877/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
b.111.1
:160 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->118 1j1hA PDBj 6e-20 58.1 %
:RPS:PDB   14->118 2czjA PDBj 5e-36 41.9 %
:RPS:SCOP  11->118 1p6vA  b.111.1.1 * 3e-32 37.1 %
:HMM:SCOP  6->138 1k8hA_ b.111.1.1 * 5.5e-51 53.8 %
:RPS:PFM   14->77 PF01668 * SmpB 5e-16 57.8 %
:HMM:PFM   12->79 PF01668 * SmpB 1.6e-33 64.7 68/68  
:BLT:SWISS 1->160 SSRP_AGRT5 4e-67 100.0 %
:PROS 32->44|PS01317|SSRP
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86833.2 GT:GENE smpB GT:PRODUCT SSRA-binding protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1018677..1019159 GB:FROM 1018677 GB:TO 1019159 GB:DIRECTION + GB:GENE smpB GB:PRODUCT SSRA-binding protein GB:PROTEIN_ID AAK86833.2 GB:DB_XREF GI:159139885 GB:GENE:GENE smpB LENGTH 160 SQ:AASEQ MAPKGSQRVVNKIVAENRKARFNYEIIDTYEAGLVLTGTEVKSLREGKANIAESYASDEGDEIWLINSHLPEYLQANRFNHEPRRRRKLLLNKREINRLRAGINRDGMTLVPLKVYFNEKGRAKLELALAKGKKLHDKRETEKERDWNRQKSRLLKGNSQ GT:EXON 1|1-160:0| SW:ID SSRP_AGRT5 SW:DE RecName: Full=SsrA-binding protein; SW:GN Name=smpB; OrderedLocusNames=Atu1025; ORFNames=AGR_C_1885; SW:KW Complete proteome; Cytoplasm; RNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->160|SSRP_AGRT5|4e-67|100.0|160/160| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| PROS 32->44|PS01317|SSRP|PDOC01021| SEG 84->100|rrrrklllnkreinrlr| SEG 119->135|ekgraklelalakgkkl| BL:PDB:NREP 1 BL:PDB:REP 14->118|1j1hA|6e-20|58.1|105/123| RP:PDB:NREP 1 RP:PDB:REP 14->118|2czjA|5e-36|41.9|105/122| RP:PFM:NREP 1 RP:PFM:REP 14->77|PF01668|5e-16|57.8|64/69|SmpB| HM:PFM:NREP 1 HM:PFM:REP 12->79|PF01668|1.6e-33|64.7|68/68|SmpB| GO:PFM:NREP 2 GO:PFM GO:0003723|"GO:RNA binding"|PF01668|IPR000037| GO:PFM GO:0006412|"GO:translation"|PF01668|IPR000037| RP:SCP:NREP 1 RP:SCP:REP 11->118|1p6vA|3e-32|37.1|105/125|b.111.1.1| HM:SCP:REP 6->138|1k8hA_|5.5e-51|53.8|132/133|b.111.1.1|1/1|Small protein B (SmpB)| OP:NHOMO 889 OP:NHOMOORG 884 OP:PATTERN -------------------------------------------------------------------- 111111111111111-111-1111111111111111111111111111111111111111111111111111111111111111-1111111111111-1111111111111111111111111111111111111111111111111111111111--1-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112211111111111111111111111111111111111111111111111111111111111111111-------11111111111111111111111111111111111111-111-111----11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--1-1-1-11-1----1111111111111111-11111 ------------------------------------------------------------------------------------------------------------2-----------------------------------------------------------------11----------------211---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 65.6 SQ:SECSTR #############cEEcHHHHTTcccccEEEEEcccccHHHHHHHccccccTTcEEEEccccEEEEcccccTTcccccccccccccEEccccHHHHHHHHHTTTTTTcccEEEEEEEc########################################## DISOP:02AL 1-13,151-153,156-161| PSIPRED ccccccccccccEEEEcccEEEEEEEEEEEEccEEEEHHHHHHHHHccccEEEEEEEEEccEEEEEEcccccccccccccccccccHHHHHcHHHHHHHHHHHHHcccEEEEEEEEEccccEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHccc //