[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ssb
DDBJ      :ssb          single-strand DNA binding protein
Swiss-Prot:SSB_AGRT5    RecName: Full=Single-stranded DNA-binding protein;         Short=SSB;AltName: Full=Helix-destabilizing protein;

Homologs  Archaea  0/68 : Bacteria  647/915 : Eukaryota  65/199 : Viruses  10/175   --->[See Alignment]
b.40.4
:173 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->114 1eygA PDBj 4e-34 56.5 %
:RPS:PDB   1->103 2cczA PDBj 2e-29 14.0 %
:RPS:SCOP  2->108 1eqqA  b.40.4.3 * 1e-31 54.7 %
:HMM:SCOP  4->173 1se8A_ b.40.4.3 * 1.9e-53 43.0 %
:RPS:PFM   5->103 PF00436 * SSB 2e-20 44.3 %
:HMM:PFM   5->106 PF00436 * SSB 4.3e-41 47.0 100/104  
:BLT:SWISS 1->173 SSB_AGRT5 2e-65 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87303.2 GT:GENE ssb GT:PRODUCT single-strand DNA binding protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1501563..1502084) GB:FROM 1501563 GB:TO 1502084 GB:DIRECTION - GB:GENE ssb GB:PRODUCT single-strand DNA binding protein GB:PROTEIN_ID AAK87303.2 GB:DB_XREF GI:159140079 GB:GENE:GENE ssb LENGTH 173 SQ:AASEQ MAGSVNKVILIGNVGADPEIRRTQDGRPIANLRIATSETWRDRNSGERKEKTEWHTVVVFNEGLCKVVEQYVKKGAKLYIEGQLQTRKWQDQTGNDRYSTEIVLQGFNSTLTMLDGRGEGGGGRSGGGDFGGGNDYGSGGGYDQQSSPRGGSSRGGGQPSGGFSNDMDDDIPF GT:EXON 1|1-173:0| SW:ID SSB_AGRT5 SW:DE RecName: Full=Single-stranded DNA-binding protein; Short=SSB;AltName: Full=Helix-destabilizing protein; SW:GN Name=ssb; OrderedLocusNames=Atu1512; ORFNames=AGR_C_2789; SW:KW Complete proteome; DNA damage; DNA repair; DNA replication;DNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->173|SSB_AGRT5|2e-65|100.0|173/173| GO:SWS:NREP 4 GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0006260|"GO:DNA replication"|DNA replication| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| SEG 115->162|dgrgeggggrsgggdfgggndygsgggydqqssprggssrgggqpsgg| BL:PDB:NREP 1 BL:PDB:REP 5->114|1eygA|4e-34|56.5|108/112| RP:PDB:NREP 1 RP:PDB:REP 1->103|2cczA|2e-29|14.0|100/121| RP:PFM:NREP 1 RP:PFM:REP 5->103|PF00436|2e-20|44.3|97/104|SSB| HM:PFM:NREP 1 HM:PFM:REP 5->106|PF00436|4.3e-41|47.0|100/104|SSB| GO:PFM:NREP 1 GO:PFM GO:0003697|"GO:single-stranded DNA binding"|PF00436|IPR000424| RP:SCP:NREP 1 RP:SCP:REP 2->108|1eqqA|1e-31|54.7|106/114|b.40.4.3| HM:SCP:REP 4->173|1se8A_|1.9e-53|43.0|165/0|b.40.4.3|1/1|Nucleic acid-binding proteins| OP:NHOMO 932 OP:NHOMOORG 722 OP:PATTERN -------------------------------------------------------------------- 111----------------------------------------------------1-------1-----------1--22111--111121212111--11224211121---------------111222112213332311131-----------11111----1-----1-1---1-11-12---11-21------------------11-----111--11---1--1-111111-1-1221111--1-1------2---1-11-----1--2111111---21-22221222212-1111111111112221112221111---------1------------2--1--1-1--211--1-11111--2--311215417111122121111111111111113-111111113111111111111111121111141211131111111111211121111111111111111111111111111111132321111122111111111122111111111311122113311211112111211111111211111111111111211111112111111112121131111121111112--2----1-------11111331111211111111111111211211111111-2111111111111112111221121221-211224211122122122131111123211121112132221331111111111111111111111111111112222111111111212311222211111221111111111111211121112111111111111211111211111111111111114324111-111111------------------------------------111-111111111 11------1-----1-----------------------------------1--------111------------------------------------------1----11111-1111-111142-11741-111--1-2111111-1111-2-1112---13-1-2111--221----111-1---1-----1---- -----------------------------1-----------1---1--------------1---------------------1----------------------1----------------1-----1-----11--------------------------------------- STR:NPRED 114 STR:RPRED 65.9 SQ:SECSTR TTcccccEEEEEEEEEEEEEEEETTTEEEEEEEEEEEEEEEETTTTEEEEEEEEEEEEEEccTTTHHHHHTccTTcEEEEEEcEEcccccccccccEEEccEEEEEEEEccccc########################################################### DISOP:02AL 1-1,44-44,111-166| PSIPRED cccccEEEEEEEEEccccEEEEcccccEEEEEEEEEcccccccccccEEcccEEEEEEEEccHHHHHHHHHcccccEEEEEEEEEEEEEEcccccEEEEEEEEEEEEccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //