[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : surE
DDBJ      :surE         stationary-phase survival protein
Swiss-Prot:SURE_AGRT5   RecName: Full=5'-nucleotidase surE;         EC=3.1.3.5;AltName: Full=Nucleoside 5'-monophosphate phosphohydrolase;

Homologs  Archaea  47/68 : Bacteria  575/915 : Eukaryota  17/199 : Viruses  0/175   --->[See Alignment]
c.106.1
:256 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->242 2phjA PDBj 1e-50 44.0 %
:RPS:PDB   1->240 2e69C PDBj 2e-71 36.3 %
:RPS:SCOP  2->248 1ilvA  c.106.1.1 * 6e-81 33.5 %
:HMM:SCOP  1->250 1l5xA_ c.106.1.1 * 1.3e-79 44.7 %
:RPS:PFM   1->184 PF01975 * SurE 4e-39 45.4 %
:HMM:PFM   1->184 PF01975 * SurE 2e-62 47.0 183/197  
:BLT:SWISS 1->256 SURE_AGRT5 e-148 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87475.1 GT:GENE surE GT:PRODUCT stationary-phase survival protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1687372..1688142) GB:FROM 1687372 GB:TO 1688142 GB:DIRECTION - GB:GENE surE GB:PRODUCT stationary-phase survival protein GB:PROTEIN_ID AAK87475.1 GB:DB_XREF GI:15156797 GB:GENE:GENE surE LENGTH 256 SQ:AASEQ MRILLTNDDGVHAEGLAVLERIARTLSDDVWIVAPETDQSGLAHSLTLSEPLRLRKVSDKHFALRGTPTDCVIMGIREVLPEKPDLVLSGVNAGANMADDVTYSGTIAGAIEGTLQGVRSFALSQAFSHGEGRVVPWEVAETYAPDLLRKLMNVDLPDGTFLNLNFPNCAPKDMQGVSVTGQGKLDFGLTVEERQDGRGLPYYWLRFGERLGTFREGTDIHALKHGKISVTPLKLDLTDYTVKDRVAQALGFGVAD GT:EXON 1|1-256:0| SW:ID SURE_AGRT5 SW:DE RecName: Full=5'-nucleotidase surE; EC=3.1.3.5;AltName: Full=Nucleoside 5'-monophosphate phosphohydrolase; SW:GN Name=surE; OrderedLocusNames=Atu1702; ORFNames=AGR_C_3128; SW:KW Complete proteome; Cytoplasm; Hydrolase; Metal-binding;Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->256|SURE_AGRT5|e-148|100.0|256/256| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| BL:PDB:NREP 1 BL:PDB:REP 4->242|2phjA|1e-50|44.0|234/248| RP:PDB:NREP 1 RP:PDB:REP 1->240|2e69C|2e-71|36.3|226/231| RP:PFM:NREP 1 RP:PFM:REP 1->184|PF01975|4e-39|45.4|183/193|SurE| HM:PFM:NREP 1 HM:PFM:REP 1->184|PF01975|2e-62|47.0|183/197|SurE| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF01975|IPR002828| RP:SCP:NREP 1 RP:SCP:REP 2->248|1ilvA|6e-81|33.5|239/246|c.106.1.1| HM:SCP:REP 1->250|1l5xA_|1.3e-79|44.7|246/276|c.106.1.1|1/1|SurE-like| OP:NHOMO 701 OP:NHOMOORG 639 OP:PATTERN 11---1----------21221221111121111111111111111111111111---11111--1--- ---------------------1-------------------1---1---------1--------1-----------------11-11111111111---1111112121211111111211111111111111111222--1111-22222212211111111221122231111111111111112211-1---------------------------------------1--------------------------------------------------------------------------------------------1--11111111111--11-----1---1--111111111111111-1--1121111-----111111111111111111111111-111111111111111111111111111111111111111---------1---1211111111111---------------1111-1-111111112222221111122221111112112122-1111111111111111111111111111111111111-1-1-111111112111111111111111111111111111111111111111111111111-1-111111111111111111111111--11111------11--1111111111111-1111111111111111111111--21111111111111111111111111111111111111111---11111111111-1111111111111111111111111-1-1-11111111111111111---------11111111111111111111111111111111-111111---------11-------------------------1111111111-1- -----------1--------------------------------------1-1-------------------1------------------------------------------------------------------------------------------------------11213---1-2234-31--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 250 STR:RPRED 97.7 SQ:SECSTR cEEEEEccccTTcHHHHHHHHHHTTTccEEEEEEEccccccccccEEEEccccTTcccccEEEEEccHHHHHHHHHHHHccccccEEEEEEEEccccGGGGTTcHHHHHHHHHHHTTcEEEEEEEccTTccHHHHcccHHHHHHHHHHHHHHHTTcccccEEEEEcccccccEcccEEEcccccccEEccEEEEEcTTccEEEEEcccEEcccccTTcHHHHHHTTcEEEEEcccccccGGGccccccHH###### DISOP:02AL 256-257| PSIPRED cEEEEEcccccccHHHHHHHHHHHHccccEEEEcccccccccccccccccccEEEEEcccEEEEccccHHHHHHHHHHHccccccEEEEccccccccccHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHccccccEEEEEEcccccHHHcccEEEEEcccccccccEEEEEcccccEEEEccccccccccccccHHHHHHcccEEEEEcccccccHHHHHHHHHHHcccccc //