[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : thiG.1
DDBJ      :thiG         thiamin biosynthesis ThiG
Swiss-Prot:THIG_AGRT5   RecName: Full=Thiazole biosynthesis protein thiG;

Homologs  Archaea  0/68 : Bacteria  617/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
c.1.31
:257 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->236 1tygA PDBj 3e-51 48.1 %
:BLT:PDB   219->253 1a05A PDBj 5e-04 48.6 %
:RPS:PDB   20->227 1dvjB PDBj 3e-21 10.3 %
:RPS:SCOP  1->242 1tygA  c.1.31.1 * 1e-85 46.5 %
:HMM:SCOP  1->241 1wv2A_ c.1.31.1 * 2.2e-74 46.7 %
:RPS:PFM   6->249 PF05690 * ThiG 2e-59 52.9 %
:HMM:PFM   4->249 PF05690 * ThiG 1.5e-109 52.7 245/247  
:BLT:SWISS 1->257 THIG_AGRT5 e-146 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88290.1 GT:GENE thiG.1 GT:PRODUCT thiamin biosynthesis ThiG GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2537959..2538732) GB:FROM 2537959 GB:TO 2538732 GB:DIRECTION - GB:GENE thiG GB:PRODUCT thiamin biosynthesis ThiG GB:PROTEIN_ID AAK88290.1 GB:DB_XREF GI:15157758 GB:GENE:GENE thiG LENGTH 257 SQ:AASEQ MLTLYGREVSSRLLLGTARYPSPAVLADAVRASNTDILTISLRREMAGAKKGGQFFELIRELDRHILPNTAGCHTAKEAVLTAKMAREVFRTDWIKLEVIGHHDTLQPDVFALVEAAKILCDEGFEVFPYTTDDLVVAEKLLEAGCRVLMPWCAPIGSAMGPLNLTALKSMRARFPEVPLIVDAGIGRPSHAVTVMELGYDAVLLNTAVAGAGDPVGMAEAFARAIEAGHQAYLSGPLEPRDMAVPSTPVIGTAVFS GT:EXON 1|1-257:0| SW:ID THIG_AGRT5 SW:DE RecName: Full=Thiazole biosynthesis protein thiG; SW:GN Name=thiG; OrderedLocusNames=Atu2566; ORFNames=AGR_C_4650; SW:KW Complete proteome; Cytoplasm; Flavoprotein; FMN;Thiamine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->257|THIG_AGRT5|e-146|100.0|257/257| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0009228|"GO:thiamin biosynthetic process"|Thiamine biosynthesis| BL:PDB:NREP 2 BL:PDB:REP 1->236|1tygA|3e-51|48.1|235/242| BL:PDB:REP 219->253|1a05A|5e-04|48.6|35/357| RP:PDB:NREP 1 RP:PDB:REP 20->227|1dvjB|3e-21|10.3|203/211| RP:PFM:NREP 1 RP:PFM:REP 6->249|PF05690|2e-59|52.9|242/245|ThiG| HM:PFM:NREP 1 HM:PFM:REP 4->249|PF05690|1.5e-109|52.7|245/247|ThiG| GO:PFM:NREP 1 GO:PFM GO:0009228|"GO:thiamin biosynthetic process"|PF05690|IPR008867| RP:SCP:NREP 1 RP:SCP:REP 1->242|1tygA|1e-85|46.5|241/242|c.1.31.1| HM:SCP:REP 1->241|1wv2A_|2.2e-74|46.7|240/0|c.1.31.1|1/1|ThiG-like| OP:NHOMO 630 OP:NHOMOORG 623 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111221111--1-----111111--111111121111---111--1-11111111111-11-----11--11111---------------1111111111----------111111111111111111111111111111111111111111111-111111111111111111111111111111--1-------111--------------11111---------------------1------------------------------------------------11-11-----------1111111-1111-111---111--111---1-1--11111111111111111111111111111111111-11111111111-1111111--111111111-1----11111111111111111111111111111-------------------1111-111111111111111111111111111111111111111111111111112211111111111111111111----11111-111111111111211111111111111111111-1-------11111111111111111111111111111111111111--1111------1111-111111111111-111111111111111111111111111111111111111111111111111-111111111-111---111111111111111111------------111111111111111111111111111111--------11111111111111111111111111111111-----------------------------------------------------1-1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1----1------------1-----1---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 257 STR:RPRED 100.0 SQ:SECSTR EHcccEEEccHHHHHHHHTcccHHHHHHHHHHHGGGccEEEEEHHHHHHHcTHHHHHHHHHHccEEEEEEEEcccHHHHHHHHHHHHHTTccEEEEEccTTEcTTcHHHHHHHHHHHHHHTcEEEEEcccccGGGGTTHHHHHHHHHHHHHHHTccEEEccTTcHHHHHHHHHHHccccEEEEccccTTcccHHHHTTTccEEEEcHHHHTcccHHHHHHHHHHHHHHHHHHHcHTcccGGGccHHTcccccccEcc DISOP:02AL 241-244| PSIPRED cEEEccEEEEcEEEEEEcccccHHHHHHHHHHHcccEEEEEEEEEcccccccccHHHHHHHcccEEcccccccccHHHHHHHHHHHHHHHcccEEEEEEEccccccccccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHHHHHHHccHHcccccccHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccc //