[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : thiG.2
DDBJ      :thiG         thiamin biosynthesis protein ThiG
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.15.3
:65 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->65 2kl0A PDBj 1e-06 33.8 %
:RPS:PDB   7->64 3cwiA PDBj 7e-08 25.9 %
:RPS:SCOP  2->65 1zud21  d.15.3.2 * 1e-10 28.1 %
:HMM:SCOP  1->65 1f0zA_ d.15.3.2 * 9.9e-13 43.1 %
:HMM:PFM   11->65 PF02597 * ThiS 2.4e-14 37.0 54/78  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88291.1 GT:GENE thiG.2 GT:PRODUCT thiamin biosynthesis protein ThiG GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2538737..2538934) GB:FROM 2538737 GB:TO 2538934 GB:DIRECTION - GB:GENE thiG GB:PRODUCT thiamin biosynthesis protein ThiG GB:PROTEIN_ID AAK88291.1 GB:DB_XREF GI:15157759 GB:GENE:GENE thiG LENGTH 65 SQ:AASEQ MKLLVNGDELDLAAETLAGLLASLDYEGEWLATAVNGDLVHSEERAGYVLKAFDRVEILSPMQGG GT:EXON 1|1-65:0| BL:PDB:NREP 1 BL:PDB:REP 1->65|2kl0A|1e-06|33.8|65/73| RP:PDB:NREP 1 RP:PDB:REP 7->64|3cwiA|7e-08|25.9|58/67| HM:PFM:NREP 1 HM:PFM:REP 11->65|PF02597|2.4e-14|37.0|54/78|ThiS| RP:SCP:NREP 1 RP:SCP:REP 2->65|1zud21|1e-10|28.1|64/65|d.15.3.2| HM:SCP:REP 1->65|1f0zA_|9.9e-13|43.1|65/0|d.15.3.2|1/1|MoaD/ThiS| OP:NHOMO 17 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11---111---------------------------11--1111--1--11-------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 100.0 SQ:SECSTR GGGGETEEEcTTccEEHHHHHHHTTcTGGGcEEEETTEEccGGGTTTcEEETTcEEEEEcccccc DISOP:02AL 64-66| PSIPRED cEEEEccEEEEEccccHHHHHHHccccccEEEEEEcccEEcHHHccEEEcccccEEEEEEEEccc //