[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ubiH
DDBJ      :ubiH         2-octaprenyl-6-methoxyphenol hydroxylase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  437/915 : Eukaryota  111/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:402 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   134->310 1dobA PDBj 1e-07 30.9 %
:RPS:PDB   81->160 3cesC PDBj 2e-05 17.5 %
:RPS:PDB   162->388 1a0eA PDBj 1e-23 6.3 %
:RPS:SCOP  32->158 1b37A1  c.3.1.2 * 2e-04 20.5 %
:RPS:SCOP  145->315 3c96A1  c.3.1.2 * 1e-20 14.0 %
:HMM:SCOP  2->392 1k0iA1 c.3.1.2 * 1.1e-50 33.0 %
:RPS:PFM   38->313 PF01494 * FAD_binding_3 3e-22 33.2 %
:HMM:PFM   5->314 PF01494 * FAD_binding_3 6e-36 25.8 306/356  
:BLT:SWISS 57->378 Y1300_SYNY3 6e-31 30.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87564.1 GT:GENE ubiH GT:PRODUCT 2-octaprenyl-6-methoxyphenol hydroxylase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1781116..1782324 GB:FROM 1781116 GB:TO 1782324 GB:DIRECTION + GB:GENE ubiH GB:PRODUCT 2-octaprenyl-6-methoxyphenol hydroxylase GB:PROTEIN_ID AAK87564.1 GB:DB_XREF GI:15156902 GB:GENE:GENE ubiH LENGTH 402 SQ:AASEQ MRHFDIAITGAGLAGQIAAIALARAGRHVALIAPSSEKKDQRTTALMDQSIRFMDRLGLWSRIAPSAARLSTMQIIDGTDRLLRAPTVQFRSSEIGLDAFGWNIPNEALLGVLSEAVEQEHNITRLDTTAETIDIGNDRISVTIADGEVLSADFLIGADGRKSMVREAAGIGVKSWSYPQTAVVLNFSHSRPHGNVSTEFHTPTGPFTQVPLPDDRSSLVWVVTPQQAEELTALPLETLSLKVEERMQSMLGAVTVENSVQAWPLSSMTAHRFGKGRVALIGEAAHGFPPIGAQGLNLSLRDIIALTELLGAVSDRPIAADAGSSFDRKRRADVYSRTLSVDLLNRSLLSDFLPVQMARAAGLHVLSGIGTLRSMVMREGIEPGRGLKALPSLLFGSFKKAG GT:EXON 1|1-402:0| BL:SWS:NREP 1 BL:SWS:REP 57->378|Y1300_SYNY3|6e-31|30.5|315/414| SEG 6->27|iaitgaglagqiaaialaragr| SEG 228->241|aeeltalpletlsl| BL:PDB:NREP 1 BL:PDB:REP 134->310|1dobA|1e-07|30.9|165/394| RP:PDB:NREP 2 RP:PDB:REP 81->160|3cesC|2e-05|17.5|80/516| RP:PDB:REP 162->388|1a0eA|1e-23|6.3|222/443| RP:PFM:NREP 1 RP:PFM:REP 38->313|PF01494|3e-22|33.2|268/338|FAD_binding_3| HM:PFM:NREP 1 HM:PFM:REP 5->314|PF01494|6e-36|25.8|306/356|FAD_binding_3| GO:PFM:NREP 2 GO:PFM GO:0004497|"GO:monooxygenase activity"|PF01494|IPR002938| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01494|IPR002938| RP:SCP:NREP 2 RP:SCP:REP 32->158|1b37A1|2e-04|20.5|127/347|c.3.1.2| RP:SCP:REP 145->315|3c96A1|1e-20|14.0|164/269|c.3.1.2| HM:SCP:REP 2->392|1k0iA1|1.1e-50|33.0|282/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 1051 OP:NHOMOORG 548 OP:PATTERN -------------------------------------------------------------------- -------------------------1------------1--1----------------------1---------------------------------------------------------------------------------1-11111121111111-111-111----1---1111-1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111222221-2322222222222222222222-2222222224212222222222222211132222222222222222212221121111111111111111111111111-1111-12211122213332221222222212222222221222111111--221211112222332311111111222221-----------------------------1---------------------------22333332332333333333333333333333--12332------33333333333333333-33333333333333333333233333333333333333333333333333331333333333333223222222222222331333-1-2----3333222222222121222222333222222222222222222333333333333333223233222222222--------------------------------------------------------- ----------1-11111111--------------------------11-11111111-11111111------1-1-----1--1111--111111-----1---1-----211111-1111111311113B2-213-1--1-111111111-1111111---1211-111-1111-----1-11111121111-1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 361 STR:RPRED 89.8 SQ:SECSTR #########################################cEEEEcHHHHHHHHHTTcHHHHHHHcEEEcEEEEEcTTccEEEEEEEEEcGGGGTccccEEEEEHHHHHHHHHHHHHHHHccEEEcEEEEEEEEETTEEEEEEEETEEEEEcEEEEcccTHHHHHHTTcccEEEEcccccccccEEccccHHHHHHHHHHHTcGGGEEEEEEHHHHHHTTccHHHHHHHHHHTTcEEEEEcTTcccccccccccHHHHHHHHHHHHHHTccccccEEEcccccTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHTGGGTcHHHHHHHHTcccHHHHHHHHTTccccccccccHHHHHcHHHHHHHHHHHHHHHHTccccHHHHHHcHHHHH DISOP:02AL 397-402| PSIPRED ccEEEEEEEcccHHHHHHHHHHHHcccEEEEEEcccccccccEEEEcHHHHHHHHHcccHHHHHHHcccEEEEEEEcccccEEcccccccccccccccccEEEEEHHHHHHHHHHHHHHcccEEEEccEEEEEEEcccEEEEEEcccEEEEEEEEEEEccccHHHHHHHccccccccccEEEEEEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEEEcccccHHHccccHHHHHHHHHHHHHHHHccccccccEEEEEEHHccccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccHHHHcccccccc //