[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ugpC.1
DDBJ      :ugpC         ABC transporter, nucleotide binding/ATPase protein (sn-Glycerol-3-phosphate)
Swiss-Prot:UGPC1_AGRT5  RecName: Full=sn-glycerol-3-phosphate import ATP-binding protein ugpC 1;         EC=3.6.3.20;

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
b.40.6c.37.1
:366 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   1->349 1g291 PDBj 2e-89 51.1 %
:RPS:PDB   1->236 3dmdC PDBj 5e-55 13.1 %
:RPS:SCOP  4->237 1b0uA  c.37.1.12 * 1e-49 32.8 %
:RPS:SCOP  240->341 1oxsC1  b.40.6.3 * 4e-12 20.2 %
:HMM:SCOP  1->235 1g2912 c.37.1.12 * 9.3e-70 41.9 %
:HMM:SCOP  237->349 1q12A1 b.40.6.3 * 2.9e-19 31.9 %
:RPS:PFM   44->163 PF00005 * ABC_tran 2e-23 44.5 %
:RPS:PFM   273->341 PF08402 * TOBE_2 8e-05 31.9 %
:HMM:PFM   44->162 PF00005 * ABC_tran 4.4e-24 34.2 114/118  
:HMM:PFM   24->62 PF03193 * DUF258 9.4e-07 36.8 38/161  
:HMM:PFM   273->324 PF08402 * TOBE_2 5.9e-05 26.9 52/75  
:BLT:SWISS 1->366 UGPC1_AGRT5 0.0 100.0 %
:PROS 135->149|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86124.1 GT:GENE ugpC.1 GT:PRODUCT ABC transporter, nucleotide binding/ATPase protein (sn-Glycerol-3-phosphate) GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 300340..301440 GB:FROM 300340 GB:TO 301440 GB:DIRECTION + GB:GENE ugpC GB:PRODUCT ABC transporter, nucleotide binding/ATPase protein (sn-Glycerol-3-phosphate) GB:PROTEIN_ID AAK86124.1 GB:DB_XREF GI:15155209 GB:GENE:GENE ugpC LENGTH 366 SQ:AASEQ MAAIEISQVCKDYHGGVRAVHHVDIDIRDGEFIVLVGPSGCGKSTLLRMVAGLEDISEGTVKIGDRVVNQTDPADRDIAMVFQNYALYPHMSVRENLEYGLKNRKTAKTEIDARVAEAARMLQLEPYLERKPRALSGGQRQRVAMGRAIVRKPAAFLFDEPLSNLDAKLRVSMRGEIKRLQKRLGTTSIYVTHDQLEAMTLADRLVVLNGGRIEQIGAPLDVYHTPASTFVASFIGSPAMNLLNAELHGDSLAIGPSLFALNGFAPTSGPVTVGMRAEDFRLAAAGEQGFAFRVDYIEELGSQRLIHGMIGDQNLTIAFPPDVDVPAALSITIASEKLHFFSSETGKRIAGKAEQLGVQSAQMATA GT:EXON 1|1-366:0| SW:ID UGPC1_AGRT5 SW:DE RecName: Full=sn-glycerol-3-phosphate import ATP-binding protein ugpC 1; EC=3.6.3.20; SW:GN Name=ugpC1; OrderedLocusNames=Atu0308; ORFNames=AGR_C_533; SW:KW ATP-binding; Cell inner membrane; Cell membrane; Complete proteome;Hydrolase; Membrane; Nucleotide-binding; Sugar transport; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->366|UGPC1_AGRT5|0.0|100.0|366/366| GO:SWS:NREP 8 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0008643|"GO:carbohydrate transport"|Sugar transport| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 135->149|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 1->349|1g291|2e-89|51.1|348/372| RP:PDB:NREP 1 RP:PDB:REP 1->236|3dmdC|5e-55|13.1|221/318| RP:PFM:NREP 2 RP:PFM:REP 44->163|PF00005|2e-23|44.5|119/123|ABC_tran| RP:PFM:REP 273->341|PF08402|8e-05|31.9|69/72|TOBE_2| HM:PFM:NREP 3 HM:PFM:REP 44->162|PF00005|4.4e-24|34.2|114/118|ABC_tran| HM:PFM:REP 24->62|PF03193|9.4e-07|36.8|38/161|DUF258| HM:PFM:REP 273->324|PF08402|5.9e-05|26.9|52/75|TOBE_2| GO:PFM:NREP 7 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| GO:PFM GO:0005215|"GO:transporter activity"|PF08402|IPR013611| GO:PFM GO:0005524|"GO:ATP binding"|PF08402|IPR013611| GO:PFM GO:0006810|"GO:transport"|PF08402|IPR013611| GO:PFM GO:0016820|"GO:hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances"|PF08402|IPR013611| GO:PFM GO:0043190|"GO:ATP-binding cassette (ABC) transporter complex"|PF08402|IPR013611| RP:SCP:NREP 2 RP:SCP:REP 4->237|1b0uA|1e-49|32.8|232/258|c.37.1.12| RP:SCP:REP 240->341|1oxsC1|4e-12|20.2|99/110|b.40.6.3| HM:SCP:REP 1->235|1g2912|9.3e-70|41.9|234/240|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 237->349|1q12A1|2.9e-19|31.9|113/0|b.40.6.3|1/1|MOP-like| OP:NHOMO 54067 OP:NHOMOORG 1173 OP:PATTERN XXMCVRLLZYZVYUcRmKRUPTQb*PTnpciZKBEFHEJIJGFWeVYnNT**jATjTXZPVLJFc19B YcyR*khitswYfSZWZSR-RnDDb*SSSSSS*wxx****Z*e****j*tnT***RWlDD***l*y****fcbbb*bZgR*lqCDDACRQSM6NFJK--HHSMNNjPZRT9AAAAAACCCEEEEIVSLUZQQWXbVt****NMN*b*qs*kkqimZaQMSMPIjjbq***hKVJOMKLSKPJKocjUQyoBdhz************************ip***mu****z***Zklmomjjklkkkkkdgcdg*oeg**hRicnyxQR**fZQdlolknsrvvtr**zxw*wxury*uyxcccbbcdegfebb*srihitrumr***********l*o****bkkh*rm*y*nwWN**ypagkpSdmfqrPgdfNiZXXPLOOMQjZ***dYw****************-z**tp*x***VB**************KNP**********VUVVVVVV*flOVog*77778888556989CD89BA7977A97B7LGGHFG************************r********AQ**w*x*sy******ewrQYKWpfKLJKLJJVTSeznf**Vjb*paswedwMdeZWVbjZYeeagy*b*KLMRHNOOPMFDADEEDEDCGTGILUTyv*T*VhNYPyUYccYPWeWUVYaYfZadd5-GNZSM311433****e************-*************xy*yxy*****imnosmooqppppmopoom*wswyyw*U4************33LJDECDEOPRPUL*s*bbaZdaKPSOOXPUgQSUTSIRIOU*f*************o***FFFDEGFEFNits*wyxyx*****VVTPRQPQSRFFEF87SURQOPLMA9798999*BdFDCCE-GDEDKIDRQNDEODGGBBCcozaZw*wvtFiP 2244dYL-gM8CTjSIELFFKNNVFTJJJCGEGRMNBKEIGHHFFEKIMTQObMIJOBDGGHBAE89927A6E9E79169CB8CCE37-ITCEGILDACDE8GMFJ6RmomcfaoimMIIGKVQzu8*F**u4yYuNMIFkHKnXDRGFEeEC*IgWV*Kp*SxRWB*il*ddiRHPJH*KOGJR*jo*I*yJMvdlhU ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 349-366| PSIPRED ccEEEEEEEEEEEcccEEEEcccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHccEEEEEEcccccccccHHHHHccHHHHccccHHHHHHHHHHHHHHcccHHHHcccHHHHcccHHHHHHHHHHHHccccEEEEEccHHHccHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHccccHHHHHHcccccEEEEEEEEEccEEEEccEEEEEccccccccEEEEEEcccEEEEccccccEEEEEEEEEEEEccEEEEEEEEccEEEEEEEcccccccccEEEEEEHHHEEEEccHHHHHHHHHHHHHHccHHHHHcc //