[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : wrbA
DDBJ      :wrbA         TrpR binding protein WrbA
Swiss-Prot:WRBA_AGRT5   RecName: Full=Flavoprotein wrbA;

Homologs  Archaea  17/68 : Bacteria  341/915 : Eukaryota  114/199 : Viruses  0/175   --->[See Alignment]
c.23.5
:199 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->198 3b6iA PDBj 8e-53 56.2 %
:RPS:PDB   2->199 2a5lA PDBj 6e-35 42.2 %
:RPS:SCOP  3->197 2arkA1  c.23.5.8 * 4e-39 32.9 %
:HMM:SCOP  1->199 2a5lA1 c.23.5.8 * 9.1e-57 43.4 %
:RPS:PFM   3->140 PF03358 * FMN_red 6e-20 39.4 %
:HMM:PFM   3->142 PF03358 * FMN_red 1.3e-12 19.5 133/146  
:BLT:SWISS 1->199 WRBA_AGRT5 e-113 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87499.2 GT:GENE wrbA GT:PRODUCT TrpR binding protein WrbA GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1713434..1714033) GB:FROM 1713434 GB:TO 1714033 GB:DIRECTION - GB:GENE wrbA GB:PRODUCT TrpR binding protein WrbA GB:PROTEIN_ID AAK87499.2 GB:DB_XREF GI:159140168 GB:GENE:GENE wrbA LENGTH 199 SQ:AASEQ MTKVLVLYYSSYGHIETMAYAVAEGVESTGAEAVVKRVPELVPEEVAKSSHFKMDQPAPVATVDELAEYDAIIVGAGTRFGTVASQMRNFWDQTGGLWFSGKLVGKVGSAFTSSATQHGGQESTILGFIPTFLHHGMAVVGLPYAFQGQMGVDEIKGGSPYGASTITDGDGSRQPSAIELDAARYQGAHVAKLAAKLSA GT:EXON 1|1-199:0| SW:ID WRBA_AGRT5 SW:DE RecName: Full=Flavoprotein wrbA; SW:GN Name=wrbA; OrderedLocusNames=Atu1728; ORFNames=AGR_C_3175; SW:KW Complete proteome; Flavoprotein; FMN. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->199|WRBA_AGRT5|e-113|100.0|199/199| BL:PDB:NREP 1 BL:PDB:REP 3->198|3b6iA|8e-53|56.2|194/197| RP:PDB:NREP 1 RP:PDB:REP 2->199|2a5lA|6e-35|42.2|166/167| RP:PFM:NREP 1 RP:PFM:REP 3->140|PF03358|6e-20|39.4|137/149|FMN_red| HM:PFM:NREP 1 HM:PFM:REP 3->142|PF03358|1.3e-12|19.5|133/146|FMN_red| RP:SCP:NREP 1 RP:SCP:REP 3->197|2arkA1|4e-39|32.9|161/184|c.23.5.8| HM:SCP:REP 1->199|2a5lA1|9.1e-57|43.4|196/0|c.23.5.8|1/1|Flavoproteins| OP:NHOMO 730 OP:NHOMOORG 472 OP:PATTERN ------1-11111111-------1----------11---------1--1-111--------------- -1--2----------11-------11-----11-----------1---------------111---3--1------------11-1-----------------1-1------------------------------11111------------------------------------------111-----1-1---------------112221---1---11--------2----------------------------------------------------------------------------------------------------------1--------------1---11---1----------212111-----21111-111111111111111111-111112111-1-122---111-3311--1--11111-1---------111---11------------------1-------------1-1-----233433111113322111111431243212223-21-11-111-111121221--------1-231---1-11--1-----11-1221--------21-------------------------22--1122-111-----------------------2222------1111-1-1-11122211-1111111111121111111111-111-11111111111111112--11111--111111111111---211111111111122---------------233332122121112111211111131111111121111---1111112212211322223222111------------------------------------------------2-------11- ------------1132112111111111111111111111-111111111121111111111643-2214433143333334345611-42113422221111545-1-3-----------------------------------------------------------1-----142-21-12345591421-A797- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 199 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEcccccHHHHHHHHHHHHHHHTTcEEEEEcccccccHHHHHHTTTccccccccccHHHHHTccEEEEEEEccTTccHHHHHHHHHTcHHHHHHTTTTTcEEEEEEEcccccccHHHHHHHHHHHHHHTTEEEcccTTccGGGccccccccccTTcccccccTTccccccHHHHHHHHHHHHHHHHHHHHHHc DISOP:02AL 169-173,175-177| PSIPRED ccEEEEEEcccccHHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHccccccccccccccHHHHHHccEEEEEcccccccccHHHHHHHHHHHHHHccccccccEEEEEEEcccccccHHHHHHHHHHHHHHcccEEEccccccHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcc //