[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : znuA
DDBJ      :znuA         ABC transporter, substrate binding protein (zinc)
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  392/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.92.2
:329 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->328 2ps3A PDBj 9e-47 39.4 %
:RPS:PDB   25->327 3cx3B PDBj 2e-43 21.3 %
:RPS:SCOP  25->329 1k0fA  c.92.2.2 * 2e-61 18.1 %
:HMM:SCOP  23->329 1pq4A_ c.92.2.2 * 1.7e-82 36.3 %
:RPS:PFM   27->295 PF01297 * SBP_bac_9 3e-29 34.6 %
:HMM:PFM   7->329 PF01297 * SBP_bac_9 2e-83 35.6 292/303  
:BLT:SWISS 27->329 ZNUA_BRUSU 6e-78 56.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87312.2 GT:GENE znuA GT:PRODUCT ABC transporter, substrate binding protein (zinc) GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1510841..1511830 GB:FROM 1510841 GB:TO 1511830 GB:DIRECTION + GB:GENE znuA GB:PRODUCT ABC transporter, substrate binding protein (zinc) GB:PROTEIN_ID AAK87312.2 GB:DB_XREF GI:159140085 GB:GENE:GENE znuA LENGTH 329 SQ:AASEQ MKSILIPLMASAALAAVASGATAAPDVVVSIKPVHSLVAAIMKGVGEPQLIVDGAASPHTYNLRPSNARKLEKADVVFWVGPGLEAFLQKPLEALASKATVVELEDAKGLEKLPFRKGGPFEAHDDGEEGHEAHAGHTEDEGAHDHGNDHAGSEEHEHGAYDTHLWLDPANAKAMAQAIETALIAADAGNAATYQANTKKLIDDLDALDAEVVETVKPVKDKPFIVFHDAYQYFEHRYGVKTAGSITVSPETLPGADRVKQMQEKVRQLGAPCVFAEPQFEPKLVSVITEGTAAKSATLDPEAATLTPGPDLYFKLMRGIAGSLKNCLS GT:EXON 1|1-329:0| BL:SWS:NREP 1 BL:SWS:REP 27->329|ZNUA_BRUSU|6e-78|56.1|303/334| SEG 10->24|asaalaavasgataa| SEG 122->144|eahddgeegheahaghtedegah| SEG 203->214|ddldaldaevve| BL:PDB:NREP 1 BL:PDB:REP 27->328|2ps3A|9e-47|39.4|259/265| RP:PDB:NREP 1 RP:PDB:REP 25->327|3cx3B|2e-43|21.3|253/255| RP:PFM:NREP 1 RP:PFM:REP 27->295|PF01297|3e-29|34.6|231/291|SBP_bac_9| HM:PFM:NREP 1 HM:PFM:REP 7->329|PF01297|2e-83|35.6|292/303|SBP_bac_9| GO:PFM:NREP 2 GO:PFM GO:0030001|"GO:metal ion transport"|PF01297|IPR006127| GO:PFM GO:0046872|"GO:metal ion binding"|PF01297|IPR006127| RP:SCP:NREP 1 RP:SCP:REP 25->329|1k0fA|2e-61|18.1|265/277|c.92.2.2| HM:SCP:REP 23->329|1pq4A_|1.7e-82|36.3|289/289|c.92.2.2|1/1|"Helical backbone" metal receptor| OP:NHOMO 477 OP:NHOMOORG 396 OP:PATTERN ----------------------------------------------1--1--1--------------1 ----111----1-1---------------------------1-1-1--------------22111--1111-------11--1---1111---1-------------------------------11-111111-111121--121221222212-----1----123212-------1----1--11-----111111121111211121--111211111-1-23333212--------------------1--------------------1----22222221112222222222222112222222223111-111121-11-----------1-111----11121--11222111---1--1-------------------1-11--1-1-11111111111------1--111112211212111111---1111111211------------111111111111-----------------1111--------------------------------------------------1-1----1---------------11---1-1--11-----1-1---------------11111-----------------1-----11--11--------------------------111111-----21211211111111111-1111111111111111111111121111111111111111111111111111-2111111-1111--1------------211111111111111111-------11-1111111111111111111---------112221111111111---------------11---------------1-----------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 282 STR:RPRED 85.7 SQ:SECSTR ########################cEEEEccHHHHHHHHHHHTHGGGcEEEccccccTTTccccHHHHHHHHHccEEEEccTTTcGGGGTcccTTTTccccEEEccTTcccccccccccccccc######################TccTTcccccccccccccGGGcHHHHHHHHHHHHHHTTTccTTcTTEEHHHHHHHHHHHHHHHHHHHHHTTTccccEEEEcccccHHHHHHTTcEEEEcccccTTccccHHHHHHHHHHHHHHcccEEEEccccccccTTTHHHHcccEEEEcccccccccccccHHHHHHHHHHHHHTccH# DISOP:02AL 1-1,249-253,255-256| PSIPRED cHHHHHHHHHHHHHHHcccccccccEEEEEEHHHHHHHHHHHccEEEEEEEEccccccccccccHHHHHHHHHccEEEEEcccHHHHHHHHHHHccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHcccEEEEEEcccccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHcccEEEEcccccccccccccHHHHHHHHHHHHHHHHc //