[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : zur
DDBJ      :zur          transcriptional regulator, Fur family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  298/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:137 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->135 2o03A PDBj 5e-09 31.1 %
:RPS:PDB   1->70 2co5B PDBj 2e-04 10.1 %
:RPS:SCOP  9->132 1mzbA  a.4.5.42 * 2e-14 24.8 %
:HMM:SCOP  9->134 1mzbA_ a.4.5.42 * 1.8e-22 35.3 %
:RPS:PFM   4->128 PF01475 * FUR 4e-12 37.3 %
:HMM:PFM   9->128 PF01475 * FUR 7.6e-14 33.9 112/120  
:BLT:SWISS 3->135 ZUR_SHIFL 4e-14 36.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87309.1 GT:GENE zur GT:PRODUCT transcriptional regulator, Fur family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1508616..1509029) GB:FROM 1508616 GB:TO 1509029 GB:DIRECTION - GB:GENE zur GB:PRODUCT transcriptional regulator, Fur family GB:PROTEIN_ID AAK87309.1 GB:DB_XREF GI:15156604 GB:GENE:GENE zur LENGTH 137 SQ:AASEQ MNAQTQQNLTKNQSLVMNALSNAHQPLSAYMILDKLRDDGFRAPLQVYRALEKLVEFGLVHRLESLNAFVACTHTQAECCSQHHGSVAFAICESCGQVTEFHDHEIDHRLERWVNDSKFKAEKTTIEIRGLCAACAA GT:EXON 1|1-137:0| BL:SWS:NREP 1 BL:SWS:REP 3->135|ZUR_SHIFL|4e-14|36.7|128/171| BL:PDB:NREP 1 BL:PDB:REP 10->135|2o03A|5e-09|31.1|119/129| RP:PDB:NREP 1 RP:PDB:REP 1->70|2co5B|2e-04|10.1|69/94| RP:PFM:NREP 1 RP:PFM:REP 4->128|PF01475|4e-12|37.3|118/120|FUR| HM:PFM:NREP 1 HM:PFM:REP 9->128|PF01475|7.6e-14|33.9|112/120|FUR| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01475|IPR002481| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01475|IPR002481| RP:SCP:NREP 1 RP:SCP:REP 9->132|1mzbA|2e-14|24.8|117/133|a.4.5.42| HM:SCP:REP 9->134|1mzbA_|1.8e-22|35.3|119/134|a.4.5.42|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 309 OP:NHOMOORG 298 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111121111111111111211111111111111-11111211111-1111111111111111111111111111111111111111111------------------------------11-1111111111111111111122111111112--------------1-------1----11------------------------------------------------------------------------111-1211211-------------------1-11111------11111111111111111-1111111111111111111112111111111111111111111111111111-11111111111111-------111111211---------------11111111111111111111111111111111111111-111111111211-111111111111111--1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 135 STR:RPRED 98.5 SQ:SECSTR ccccTTccHHHHHHHHHHHHTTcTEEEGGGHHHHHHHHHccccHHHHHHHHHHHHHTTcEEEEccTTccEEcccEEEEEccccccEE#EEEETTTccEEEEccHHHHHHHHHHHHHTTccccccccEEEEccTTTH# DISOP:02AL 1-2| PSIPRED ccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEccccEEEcccccccccccccccEEEEEEcccccEEEcccccHHHHHHHHHHHHccEEEEEEEEEEEEccHHcc //