[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 1
DDBJ      :1            dNMP kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  5/175   --->[See Alignment]
c.37.1
:224 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->223 1delA PDBj 3e-34 40.6 %
:RPS:PDB   2->223 1delA PDBj 4e-18 32.7 %
:RPS:SCOP  2->223 1dekA  c.37.1.1 * 2e-18 35.5 %
:HMM:SCOP  1->223 1dekA_ c.37.1.1 * 4.1e-17 23.8 %
:HMM:PFM   133->169 PF08941 * USP8_interact 0.00055 27.0 37/179  
:BLT:SWISS 2->223 DNMK_BPT4 1e-33 40.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81452.1 GT:GENE 1 GT:PRODUCT dNMP kinase GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(74863..75537) GB:FROM 74863 GB:TO 75537 GB:DIRECTION - GB:GENE 1 GB:PRODUCT dNMP kinase GB:FUNCTION converts dTMP, dGMP and HMdCMP to diphosphates, not active on dAMP or dCMP GB:NOTE similar to T4 accession NP_049752.1; gp1 GB:PROTEIN_ID AAQ81452.1 GB:DB_XREF GI:34732914 GB:GENE:GENE 1 LENGTH 224 SQ:AASEQ MIIALSAKKRCGKDTVGDILVSNGFTKYALAEPIKRFLYLSIHEDSKLPMFVQDFNMDDFNGLGYDREAGLPISNSDVFRIMRSAWMLVSDDQGFDFTYAHTGKIAEVVLGNKEAWSIRRLMQTFGTDIGCAINKRIWMKYLTDFIPTHKNIVVTDCRQDHEMEEMRSLGAHVVHILRDNQEIRVDMHSTEQGLPIQSGDHVINNDGSIDDLRQVVNNLINYIK GT:EXON 1|1-224:0| BL:SWS:NREP 1 BL:SWS:REP 2->223|DNMK_BPT4|1e-33|40.6|217/241| BL:PDB:NREP 1 BL:PDB:REP 2->223|1delA|3e-34|40.6|217/241| RP:PDB:NREP 1 RP:PDB:REP 2->223|1delA|4e-18|32.7|220/241| HM:PFM:NREP 1 HM:PFM:REP 133->169|PF08941|0.00055|27.0|37/179|USP8_interact| RP:SCP:NREP 1 RP:SCP:REP 2->223|1dekA|2e-18|35.5|220/241|c.37.1.1| HM:SCP:REP 1->223|1dekA_|4.1e-17|23.8|206/0|c.37.1.1|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-------------------------------111-1--------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 222 STR:RPRED 99.1 SQ:SECSTR #EEEEEccTTccHHHHHHHHHHHcEEEccTTHHHHHHHHHHHHHHTTTccccccccHHHHTTTTccTTccccccHHHHHHHHHHHHHHHHTTcccTTccEEEccccEEEcHHHHHcHHHHHHHHHTTTHHHHTcTTHHHHHHHHTTccccEEEEcccccHHHHHHHHHTTcEEEEEEcccccccccccTTcccccccTTcEEEEccccHHHHHHHHHHHHHHc# PSIPRED cEEEEEccccccHHHHHHHHEEcccEEEEEEccHHHHHHHHHHccccccEEEccccccccccccccccccccccHHHHHHHHHHHHHHccccccccEEEEcHHHHHHccccccccccHHHHHHHHccHHEEcccccccHHHHHHHccccccEEEcccccHHHHHHHHHcccEEEEEEcccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHHHc //