[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 13
DDBJ      :13           neck protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  6/175   --->[See Alignment]
:307 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   123->185 PF00877 * NLPC_P60 0.00062 18.6 59/105  
:BLT:SWISS 3->277 VG13_BPT4 3e-88 58.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81468.1 GT:GENE 13 GT:PRODUCT neck protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION 93332..94255 GB:FROM 93332 GB:TO 94255 GB:DIRECTION + GB:GENE 13 GB:PRODUCT neck protein GB:NOTE similar to T4 accession NP_049772.1; neck or collar protein; gp13 GB:PROTEIN_ID AAQ81468.1 GB:DB_XREF GI:34732930 GB:GENE:GENE 13 LENGTH 307 SQ:AASEQ MSYTCNNPLELKDAILRRLGAPIVHVEVTEEQVFDCISRALELYGEYHYDGFHRTYATVVLTEQQAKTGIIDMKGGNVFAVTQVLRTNVGSIITMDGTAVYPWFTDFVMGMTGASIGGQCKWYGPNAFGGDLGYFTQLMSYRSMMGDLLSPLPDFYYNSSSEMMKIAGQFKAGDLIVFEVYCKSYANVDTMLAGTSAGYGFAMSCDGDEPSQSQLYGNPNLAGGAIYAGGSNGMLKDGAYNNRWVKDMSTAYVKELNGQVLAKHQGMQLPGGITIDGVRLIEEARIDIDKLRNELELLDAPPPIIMG GT:EXON 1|1-307:0| BL:SWS:NREP 1 BL:SWS:REP 3->277|VG13_BPT4|3e-88|58.4|269/309| HM:PFM:NREP 1 HM:PFM:REP 123->185|PF00877|0.00062|18.6|59/105|NLPC_P60| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1---------------1---------------111-1--------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED cccccccHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHHHccccHHcEEEEEEEcHHHHcccEEEcccccEEEEEEEEEEccccEEEEcccEEccHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccEEcccccEEEEEEccccccEEEEEEEccccccHHHHHHccccccEEEcccccccccHHHHcccHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEccEEEEEHHHHHHHHHHHHHHHcccccccccc //