[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 14
DDBJ      :14           neck protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  9/175   --->[See Alignment]
:252 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   6->249 PF11649 * T4_neck-protein 2e-71 61.5 %
:HMM:PFM   19->249 PF11649 * T4_neck-protein 5.7e-95 52.4 227/231  
:BLT:SWISS 3->247 VG14_BPT4 5e-80 58.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81469.1 GT:GENE 14 GT:PRODUCT neck protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION 94262..95020 GB:FROM 94262 GB:TO 95020 GB:DIRECTION + GB:GENE 14 GB:PRODUCT neck protein GB:NOTE similar to T4 accession NP_049773.1; neck or collar protein; gp14 GB:PROTEIN_ID AAQ81469.1 GB:DB_XREF GI:34732931 GB:GENE:GENE 14 LENGTH 252 SQ:AASEQ MMDKSLFATLENRGGYMRTNEKNILNPYVKFNKHEGTQALQDTLVAESIQMRGIEFYYLEREFTDLDLLFGEDVNSRFEKAWKFAAWLNSFESYEGQQSFFSKFGHTQNDEIRISINPGLFKYQVNGKEPALGDLIYMPMDNSLFEITWVEPYSPFYQNGKNPIRVIVAQKFIYSGEKITPVVQEKPEIEDMYNGLDLAPLLNLDGMIDQKIDQFAENIAVQQKVKQYAEPFDPISTNSFGNFDSPFGKHEA GT:EXON 1|1-252:0| BL:SWS:NREP 1 BL:SWS:REP 3->247|VG14_BPT4|5e-80|58.4|245/256| RP:PFM:NREP 1 RP:PFM:REP 6->249|PF11649|2e-71|61.5|239/245|T4_neck-protein| HM:PFM:NREP 1 HM:PFM:REP 19->249|PF11649|5.7e-95|52.4|227/231|T4_neck-protein| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-1-------------1---11----------111-1--------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,247-253| PSIPRED cccccEEEEEEccccHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHHccEEEEEEEHHHccHHHHccHHHHHHHHHHHHHEEEEEccccccccHHHHHHcccEEccEEEEEEcccHHHHcccccccccccEEEEEccccEEEEEEEccccccEEcccccEEEEEEEEEEEEccccccHHccccccccccccccHHHHHcccccEEcccccccHHHHHHHHHHHHcccccccccccccccccccccccc //