[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 15
DDBJ      :15           tail sheath stabilizer and completion protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  9/175   --->[See Alignment]
:272 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   20->92 PF07728 * AAA_5 1.6e-05 23.2 69/139  
:HMM:PFM   227->265 PF01739 * CheR 0.00076 26.3 38/196  
:BLT:SWISS 1->261 VG15_BPT4 3e-65 47.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81470.1 GT:GENE 15 GT:PRODUCT tail sheath stabilizer and completion protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION 95023..95841 GB:FROM 95023 GB:TO 95841 GB:DIRECTION + GB:GENE 15 GB:PRODUCT tail sheath stabilizer and completion protein GB:NOTE similar to T4 accession NP_049774.1; connector protein to gp3 and/or gp19; gp15 GB:PROTEIN_ID AAQ81470.1 GB:DB_XREF GI:34732932 GB:GENE:GENE 15 LENGTH 272 SQ:AASEQ MFGNHFYNNSIRRYIMLLMELFGHIQVARQRDGKPYFQDVPITYASKEKFIMALGDVTMPTSEAQIAKVESILPRMNLHLIDAQYNAQVKTGAAQKRWVNKSDGKGLAQFNPVPYTFMFELGIHTRHEDDLFQIIEQILPYFQPHFPCTITELYDNEIIIKGRDINIVIVSNTPDEQIEGPGEQRRRLEWSMMLSFTGWLYPNTKNIAGEIRTIYIDFFGNEREINKETHFESVDHQVVPKNVPKQEWTGESIEVWSDNTSQGEPPRPSSGE GT:EXON 1|1-272:0| BL:SWS:NREP 1 BL:SWS:REP 1->261|VG15_BPT4|3e-65|47.5|259/272| HM:PFM:NREP 2 HM:PFM:REP 20->92|PF07728|1.6e-05|23.2|69/139|AAA_5| HM:PFM:REP 227->265|PF01739|0.00076|26.3|38/196|CheR| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-1-------------1---11----------111-1--------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 261-273| PSIPRED ccccHHHHHHHHHHHHHHHHHHccEEEEEEccccccEEEEEEEEccHHHEEEEccccccccccccEEEEEEEccccccEEEEEEEccccccccccccEEEcccccEEEEcccccEEEEEEEEEEEEccHHHHHHHHHHHccccccccEEEEEEcccccccccccEEEEEEEcccccccccccccEEEEEEEEEEEEEEEEcccHHHHcccEEEEEEEEccccEEEcccccEEEccEEEccccccHHHcccEEEEEEcccccccccccccccc //