[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 16
DDBJ      :16           terminase DNA packaging enzyme small subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  6/175   --->[See Alignment]
:154 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   64->118 2cghA PDBj 5e-04 23.5 %
:RPS:PFM   1->111 PF11053 * DNA_Packaging 3e-30 64.5 %
:HMM:PFM   1->149 PF11053 * DNA_Packaging 4.5e-69 65.7 143/153  
:BLT:SWISS 5->111 VG16_BPT4 7e-37 63.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81471.1 GT:GENE 16 GT:PRODUCT terminase DNA packaging enzyme small subunit GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION 95845..96309 GB:FROM 95845 GB:TO 96309 GB:DIRECTION + GB:GENE 16 GB:PRODUCT terminase DNA packaging enzyme small subunit GB:NOTE similar to T4 accession NP_049775.1; gp16 GB:PROTEIN_ID AAQ81471.1 GB:DB_XREF GI:34732933 GB:GENE:GENE 16 LENGTH 154 SQ:AASEQ MNDVLDFTQLKDLNGIEGIHGEDVQVYAPLVLRDPVSNPNNRKIDQDDDYELVRRNMHYQSQMLLDMAKIALENAKNADSPRHVEVFAQLMGQMTTTNKEMLKMHKEMKDLAGAATVAIDGQVQKDADGEFIEFEGSPDELLDLELADEDIGDD GT:EXON 1|1-154:0| BL:SWS:NREP 1 BL:SWS:REP 5->111|VG16_BPT4|7e-37|63.6|107/164| SEG 139->153|delldleladedigd| RP:PDB:NREP 1 RP:PDB:REP 64->118|2cghA|5e-04|23.5|51/238| RP:PFM:NREP 1 RP:PFM:REP 1->111|PF11053|3e-30|64.5|110/150|DNA_Packaging| HM:PFM:NREP 1 HM:PFM:REP 1->149|PF11053|4.5e-69|65.7|143/153|DNA_Packaging| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1---------------1---------------111-1--------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 51 STR:RPRED 33.1 SQ:SECSTR ###############################################################cccHHHHHHHHccTTccccEEEEEccc####ccHHHHHHHHHHTTccccTEEEEE#################################### DISOP:02AL 1-2,118-121,124-124,150-150,152-155| PSIPRED ccHHHHHHHHHHccccccccccccEEEcccccccccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHccHHccccHHHHHHHHHcccccccc //