[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 19
DDBJ      :19           tail tube protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  9/175   --->[See Alignment]
:162 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   19->162 PF06841 * Phage_T4_gp19 3.9e-14 18.3 131/134  
:BLT:SWISS 1->162 VG19_BPT4 3e-60 64.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81474.1 GT:GENE 19 GT:PRODUCT tail tube protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION 100255..100743 GB:FROM 100255 GB:TO 100743 GB:DIRECTION + GB:GENE 19 GB:PRODUCT tail tube protein GB:NOTE similar to T4 accession NP_049781.1; inner tube protein of phage tail; gp19 GB:PROTEIN_ID AAQ81474.1 GB:DB_XREF GI:34732936 GB:GENE:GENE 19 LENGTH 162 SQ:AASEQ MDVTDVLRAFESGDFARPNLFEVEIPFLGQNFKFKCKAGTMPAATVEKIPVGYMNRKLNIAGDRIYDDWTVTIYNDSAHITRQAIVDWNAMTHGMGNTITGDIPEAYKKPGVVRQKDRNGESTKEYAIIGLFPTNVGEVTLDWDDNNTVSTFEVTFALDWWE GT:EXON 1|1-162:0| BL:SWS:NREP 1 BL:SWS:REP 1->162|VG19_BPT4|3e-60|64.8|162/163| HM:PFM:NREP 1 HM:PFM:REP 19->162|PF06841|3.9e-14|18.3|131/134|Phage_T4_gp19| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-1-------------1---11----------111-1--------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cccHHHHHHHHccccccccEEEEEEcccccccEEEEEEEEcccccEEEEccccccccEEEccccEEccEEEEEEccHHHHHHHHHHHHHHHHcccccccccccHHHcccEEEEEEEEccccEEEEEEEEEEEEEEEccEEEccccccEEEEEEEEEEEEEEc //