[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 2
DDBJ      :2            DNA end protector protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  5/175   --->[See Alignment]
:268 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 2->266 VG02_BPT4 6e-80 54.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81454.1 GT:GENE 2 GT:PRODUCT DNA end protector protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(76252..77058) GB:FROM 76252 GB:TO 77058 GB:DIRECTION - GB:GENE 2 GB:PRODUCT DNA end protector protein GB:NOTE similar to T4 accession NP_049754.1; T4 gene synonym: 64; gp2 GB:PROTEIN_ID AAQ81454.1 GB:DB_XREF GI:34732916 GB:GENE:GENE 2 LENGTH 268 SQ:AASEQ MIFDYIDEAPVKKTRNQWVDLGVKWRNAKAKGVSGRDFAKANGLNFDTFRRTMLKFAKQIDLAIEVESLKNKAKLNSREKALAMINDFRSQMRARAADSGAANNNKSQKWFDDTIRKSIRGHMVAKPKPGRIYTFAYDAKHKDTLEYWDKFPLIVFLGIGSSGSGPLLYGLNLHYIPPKARQSFLEELLKNYASTERLSNKTTLKINWSNVRGMSGSDVMIKAYLPGHIKGSMMEIKPSDWVNVIYMPLQQFVSKGKRYSARKVWAKA GT:EXON 1|1-268:0| BL:SWS:NREP 1 BL:SWS:REP 2->266|VG02_BPT4|6e-80|54.4|261/274| SEG 157->173|lgigssgsgpllyglnl| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-------------------------------111-1--------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 66-81,95-109,267-269| PSIPRED ccEEEEccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccccEEEEEEEEccccccccccccccEEEEEEccccccccEEEEEEEEcccHHHHHHHHHHHHHHHccccccccccEEEEcHHHHcccccHHHHHHHHccccccccEEEEcccccccEEEEHHHHHHHHcccccHHHHHHcc //