[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 23
DDBJ      :23           major capsid protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  10/175   --->[See Alignment]
:529 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   261->508 1yueA PDBj 1e-08 31.4 %
:RPS:PFM   235->304 PF07068 * Gp23 1e-18 70.1 %
:HMM:PFM   9->510 PF07068 * Gp23 3.9e-263 71.7 492/493  
:BLT:SWISS 1->529 COAT_BPT4 0.0 72.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAF61693.2 GT:GENE 23 GT:PRODUCT major capsid protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION 104458..106047 GB:FROM 104458 GB:TO 106047 GB:DIRECTION + GB:GENE 23 GB:PRODUCT major capsid protein GB:NOTE similar to T4 accession NP_049787.1; structural head protein; gp23 GB:PROTEIN_ID AAF61693.2 GB:DB_XREF GI:34850740 GB:GENE:GENE 23 LENGTH 529 SQ:AASEQ MSLKNKEILNKWTPLLEGEGLPEIAGKNKQALVAQILEAQEKDSKSDPVYRDDKLIEAFGQSLMEAEVAGDHGYDPTNIAAGQSSGAITNIGPAVIGMVRRAIPSLIAFDIAGVQPMTGPTGQVFALRSVYGKDPLAAGAKEAFHPMYAPDAWHSSLATKGATTTTDGTPFAKLTAGQAIAEGDIVGHFFYESGTAFLQNVSGASVTVGTNETGEALDKLINAAIGEGKLAEIAEGMATSIAELRQGFNGSNDNPWNEMSFRIDKQTVEAKSRQLKAQYSIELAQDLRAVHGMDADSELNGILANEVMLEINREVIDWINYTAQVGKSGWTKTDGSASGVFDFQDPIDVRGARWAGESYKALLIQIDKEANEIARQTGRGAGNFIIASRNVVSALALIDTNISPAAQGMASGLNADTTKGVFAGILGGRYKVYIDQYARQDYFTMGYRGANNLDAGIYYCPYVALTPLRGSDPKNFQPVMGFKTRYAIGVNPFAESRTQAPQGRITSGMPGVNSVGKNAYFRRVWVKGL GT:EXON 1|1-529:0| BL:SWS:NREP 1 BL:SWS:REP 1->529|COAT_BPT4|0.0|72.6|518/521| SEG 158->169|atkgattttdgt| BL:PDB:NREP 1 BL:PDB:REP 261->508|1yueA|1e-08|31.4|220/385| RP:PFM:NREP 1 RP:PFM:REP 235->304|PF07068|1e-18|70.1|67/76|Gp23| HM:PFM:NREP 1 HM:PFM:REP 9->510|PF07068|3.9e-263|71.7|492/493|Gp23| OP:NHOMO 13 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-1-------------2---11----------21211--------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 220 STR:RPRED 41.6 SQ:SECSTR ####################################################################################################################################################################################################################################################################ccEEEEEEEcEEEEEEEEEETTHHHHHHH#TcTTcTTHHHHHHHHHHH#HHHHHHHHHHHHHcc####ccccTHHHHHTTcc####ccTTccccccHHHHHHHHHHHHHcTTcccEEEccHHHHTTTTTTcEEccccTTccccTTccEETTcc#################EEEEccccTTcEEEEEcETTEEEEccEEEEEcEEEEcccccEccccccEEEEEEEEEEEEcGGGTcccT#TTTTTccc##################### DISOP:02AL 1-4,6-6| PSIPRED ccccHHHHHHHHHHHHccccccHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccHHHHccccccccccccccHHHHHHHHHHHHHHHHHHEEEEcccccHHHHHHHHHHHcccccccccHHHccccccccccccHHcccccccccccccccccccccEEEEEEEEEccHHHcccEEEEEEccccccccccccccccHHHHHHHHHccEEEHHHccccccHHHHcccccccccccccccEEEEEEEEEEHHHHcccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEccccccccEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEHHHHHHHHHHHccccccccccccccccccccccEEEEEEccccEEEEEccccccEEEEEEcccccEEEEEEEcccccccccccccccccccEEEEEEEEEEEccccccccccccccEEEcccccccccccccEEEEEEEEcc //