[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 25
DDBJ      :25           baseplate wedge subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  7/175   --->[See Alignment]
d.373.1
:127 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->92 2ia7A PDBj 1e-05 30.4 %
:RPS:SCOP  23->116 2ia7A1  d.373.1.1 * 1e-17 24.5 %
:HMM:PFM   25->115 PF04965 * GPW_gp25 1.1e-18 24.7 89/99  
:BLT:SWISS 2->127 VG25_BPT4 6e-39 55.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81496.1 GT:GENE 25 GT:PRODUCT baseplate wedge subunit GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(115991..116374) GB:FROM 115991 GB:TO 116374 GB:DIRECTION - GB:GENE 25 GB:PRODUCT baseplate wedge subunit GB:NOTE similar to T4 accession NP_049800.1; gp25 GB:PROTEIN_ID AAQ81496.1 GB:DB_XREF GI:34732959 GB:GENE:GENE 25 LENGTH 127 SQ:AASEQ MNINMLYSDLDPNFGKSWDNDVLMTKGSRAVKNSIIGIVSTPIGSRAFNPYFGCDLPDQLFENITPLVIDTVERNIKTAIRNFEPRVYNLTVDSIGNFDNNELIVTIRFSIVDNPALIDEIKMRLSN GT:EXON 1|1-127:0| BL:SWS:NREP 1 BL:SWS:REP 2->127|VG25_BPT4|6e-39|55.6|126/132| BL:PDB:NREP 1 BL:PDB:REP 23->92|2ia7A|1e-05|30.4|69/109| HM:PFM:NREP 1 HM:PFM:REP 25->115|PF04965|1.1e-18|24.7|89/99|GPW_gp25| RP:SCP:NREP 1 RP:SCP:REP 23->116|2ia7A1|1e-17|24.5|94/111|d.373.1.1| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-1-------------1---------------111-1--------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 79.5 SQ:SECSTR ######################ccccHHHHHHHHHHHHHTccTTccT#cTTcccGGGGcccccccHHHHHHHHHHHHHHHHHHcTTEEEEEEHHHHHHHHT#ccHHHHHHHHHcHHHHHHHHHHH## DISOP:02AL 1-3,127-128| PSIPRED cccccccccccccccccccccEEEEccHHHHHHHHHHHHccccccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHccccEEEEEEEEEEcccccEEEEEEEEEEEcccHHHHHHHHHccc //