[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 26
DDBJ      :26           baseplate hub subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  4/175   --->[See Alignment]
:204 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   18->193 PF12322 * T4_baseplate 4e-23 35.8 %
:HMM:PFM   1->197 PF12322 * T4_baseplate 1.2e-61 34.5 197/205  
:BLT:SWISS 7->193 VG26_BPT4 2e-14 26.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81497.1 GT:GENE 26 GT:PRODUCT baseplate hub subunit GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(116371..116985) GB:FROM 116371 GB:TO 116985 GB:DIRECTION - GB:GENE 26 GB:PRODUCT baseplate hub subunit GB:NOTE similar to T4 accession NP_049801.1; gp26 GB:PROTEIN_ID AAQ81497.1 GB:DB_XREF GI:34732960 GB:GENE:GENE 26 LENGTH 204 SQ:AASEQ MQIKMTIGGKAVETDMLTVSEYLGLVNSYSINSPEEAVNQTIESRFGELPKHLAEQAFVKLVALSKRKQIKMKTKCTCGNEHSFVVSPDAISVTSDDALTHHAGGVIINLRHPKMFEDRDPFEMVDRCLVSFEHDGQVISWDNASDLEKDLLFKQLHIDDIRQIVGKLSANKIYAVVPLSCECGNQWPAVIEGPGAILGALGVK GT:EXON 1|1-204:0| BL:SWS:NREP 1 BL:SWS:REP 7->193|VG26_BPT4|2e-14|26.7|187/208| RP:PFM:NREP 1 RP:PFM:REP 18->193|PF12322|4e-23|35.8|176/204|T4_baseplate| HM:PFM:NREP 1 HM:PFM:REP 1->197|PF12322|1.2e-61|34.5|197/205|T4_baseplate| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-------------------------------1-1-1--------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cEEEEEEccEEEEEEHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccEEEccccEEEEEEHHHEEEccccccEEEEccEEEEEEcccccccccHHHHHHcccEEEEEccEEEEHHHccHHHHHHHHHHccHHHHHHHHHHHcccccEEEEEEEccccccccEEEEcHHHHHHHHccc //