[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 28
DDBJ      :28           baseplate hub distal subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  4/175   --->[See Alignment]
:175 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   23->175 PF11110 * Phage_hub_GP28 2e-45 57.0 %
:HMM:PFM   23->175 PF11110 * Phage_hub_GP28 4.6e-75 59.6 151/151  
:BLT:SWISS 5->157 VG28_BPT4 4e-27 37.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81500.1 GT:GENE 28 GT:PRODUCT baseplate hub distal subunit GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION 118890..119417 GB:FROM 118890 GB:TO 119417 GB:DIRECTION + GB:GENE 28 GB:PRODUCT baseplate hub distal subunit GB:NOTE similar to T4 accession NP_049804.2; gp28 GB:PROTEIN_ID AAQ81500.1 GB:DB_XREF GI:34732963 GB:GENE:GENE 28 LENGTH 175 SQ:AASEQ MKPRLNIIPAVKIINVNGKEIKIPKLGFRQMKLMKDMQGVDDCMVGLLDSIRPGLTAAEADMVILHLLAFNKRIQTVQLVGGVEIDIDKAYMCAVYDFDFDGKTIHFKAPAVTDRFVSKIDILEKQFDRDKTGFDFDFREAPAFVLDWADEIIATIALDTPVGTIYGGSSIVGTI GT:EXON 1|1-175:0| BL:SWS:NREP 1 BL:SWS:REP 5->157|VG28_BPT4|4e-27|37.3|153/177| RP:PFM:NREP 1 RP:PFM:REP 23->175|PF11110|2e-45|57.0|149/149|Phage_hub_GP28| HM:PFM:NREP 1 HM:PFM:REP 23->175|PF11110|4.6e-75|59.6|151/151|Phage_hub_GP28| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-------------------------------1-1-1--------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccccEEEEEEEEEEccEEEEEccHHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccEEEEEEcccEEEEEEEEEEEEEEEEEcccEEEEcccccccccccHHHHHHHHHccccccccccHHHHHHHHHHHHcccEEEEEEccccccEEccHHEEEcc //