[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 3
DDBJ      :3            tail completion and sheath stabilizer protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  6/175   --->[See Alignment]
:175 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->162 PF06841 * Phage_T4_gp19 4.4e-15 17.6 131/134  
:BLT:SWISS 5->173 VG03_BPT4 1e-33 38.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81453.1 GT:GENE 3 GT:PRODUCT tail completion and sheath stabilizer protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(75539..76066) GB:FROM 75539 GB:TO 76066 GB:DIRECTION - GB:GENE 3 GB:PRODUCT tail completion and sheath stabilizer protein GB:NOTE tail sheath stabilizer terminator; similar to T4 accession NP_049753.1; gp3 GB:PROTEIN_ID AAQ81453.1 GB:DB_XREF GI:34732915 GB:GENE:GENE 3 LENGTH 175 SQ:AASEQ MALNNQSNITNFLLDIPASAGIKVALMNVQQASIPGFRIPPTELPLGEQGTARQNIPSTTTEFDPLIVRILLDEDYDAYFEIYRWMLSINDYARQTPTMWGTTSQPPGVTLHVLSNSKHDIVASFNYQGAWPSEIGEIEYSYTEEGDVSAYFTVTFFFKYFEIERKGQLVRPIRG GT:EXON 1|1-175:0| BL:SWS:NREP 1 BL:SWS:REP 5->173|VG03_BPT4|1e-33|38.9|167/176| HM:PFM:NREP 1 HM:PFM:REP 11->162|PF06841|4.4e-15|17.6|131/134|Phage_T4_gp19| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1---------------1---------------111-1--------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,6-6| PSIPRED cccccccccccEEEEEEccccEEEEEEEEcccccccEEEccEEEEccccccccccccccccEEccEEEEEEEcHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEcccccEEEEEEEEcccEEEEcccEEEEEEEccccEEEEEEEEEEEEEEEEccEEEEEEEcc //