[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 30.2
DDBJ      :30.2         hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  5/175   --->[See Alignment]
c.108.1
:234 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->105 1l6rA PDBj 1e-04 30.2 %
:RPS:PDB   8->187 3cnhA PDBj 2e-05 13.9 %
:RPS:SCOP  7->189 2b0cA1  c.108.1.2 * 2e-05 11.2 %
:HMM:SCOP  1->207 1u7pA_ c.108.1.17 * 0.00066 20.0 %
:BLT:SWISS 5->216 Y12F_BPT4 5e-41 42.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81509.1 GT:GENE 30.2 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(129821..130525) GB:FROM 129821 GB:TO 130525 GB:DIRECTION - GB:GENE 30.2 GB:PRODUCT hypothetical protein GB:NOTE similar to T4 accession NP_049815.1; gp30.2 GB:PROTEIN_ID AAQ81509.1 GB:DB_XREF GI:34732972 GB:GENE:GENE 30.2 LENGTH 234 SQ:AASEQ MQIEKPIILTDVDGVLVQWTSGLPYFAQKNGIRTDEILKTLVDERFRTGEELFGVNGRIADILMREYNNSDFIKYLAGYVDAIDVVNRLKEHYDFIAITALGDSNQALMNRCCNLNTLFPGAFKDILCVDIGETKMPHYISVKQKYKDRLVCFVDDLVSNLQDCHDAMSQLPQIHMLRTENAREVKHDIAKYHTAKNWYDIEKLLVNLNPKPIKMDLSHLSTWEDKPVTIEAKA GT:EXON 1|1-234:0| BL:SWS:NREP 1 BL:SWS:REP 5->216|Y12F_BPT4|5e-41|42.1|209/278| BL:PDB:NREP 1 BL:PDB:REP 8->105|1l6rA|1e-04|30.2|96/225| RP:PDB:NREP 1 RP:PDB:REP 8->187|3cnhA|2e-05|13.9|173/192| RP:SCP:NREP 1 RP:SCP:REP 7->189|2b0cA1|2e-05|11.2|179/197|c.108.1.2| HM:SCP:REP 1->207|1u7pA_|0.00066|20.0|155/0|c.108.1.17|1/1|HAD-like| OP:NHOMO 6 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1---------------2---------------11--1--------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 196 STR:RPRED 83.8 SQ:SECSTR #######EEEcccTTTcccccHHHHHHHHHTccHHHHHHHHHHHTTccHHHHHHHHTTTccccccHHHHHHHHHTccccHHHHHHHHHHTTTcEEEEEcccHHHHHHHHHHHTTcGGGGGGTcccEEEHHHHccTTcHHHHHHHHTccGGGEEEEccHHHHHHHHHT##TEEEEcccHHHHHHHHHHc####EEEccGGGHHHHHTccc######################### DISOP:02AL 1-3,233-235| PSIPRED ccccccEEEEEEccEEEEcccccHHHHHHccccHHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHcHHccEEcccccHHHHHHHHHHHHHccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHEEEEccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccEEEEcccccHHHcccccHHHcccccHHHHHHHHHcccccHHHHccccccccccccEEEEEcc //