[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 30.3
DDBJ      :30.3         hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  5/175   --->[See Alignment]
d.336.1
:149 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   4->119 2b3wA PDBj 1e-09 16.7 %
:RPS:SCOP  6->149 2b3wA1  d.336.1.1 * 2e-10 19.5 %
:HMM:SCOP  5->150 2b3wA1 d.336.1.1 * 4.2e-22 29.9 %
:RPS:PFM   1->146 PF08010 * Phage_30_3 1e-38 51.4 %
:HMM:PFM   1->146 PF08010 * Phage_30_3 1.5e-83 68.5 146/146  
:BLT:SWISS 1->146 Y12G_BPT4 8e-24 40.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81436.1 GT:GENE 30.3 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(65473..65922) GB:FROM 65473 GB:TO 65922 GB:DIRECTION - GB:GENE 30.3 GB:PRODUCT hypothetical protein GB:NOTE similar to T4 accession NP_049816.1 GB:PROTEIN_ID AAQ81436.1 GB:DB_XREF GI:34732898 GB:GENE:GENE 30.3 LENGTH 149 SQ:AASEQ MDIGSGASWPSCALSNFAPHEFYIDGVRCASIEGFLQSLKFKSPEMQEHVCSLVGKAAKFKGKKKNWWRDQTLYWRGKPMHRQSDAYSELISRAYDEVSKNSGFKRAILATRNSSLTHSMGKNKKNETVLTEQEFCSNLYRVRDSLQAG GT:EXON 1|1-149:0| BL:SWS:NREP 1 BL:SWS:REP 1->146|Y12G_BPT4|8e-24|40.4|146/152| SEG 55->65|gkaakfkgkkk| RP:PDB:NREP 1 RP:PDB:REP 4->119|2b3wA|1e-09|16.7|108/168| RP:PFM:NREP 1 RP:PFM:REP 1->146|PF08010|1e-38|51.4|146/150|Phage_30_3| HM:PFM:NREP 1 HM:PFM:REP 1->146|PF08010|1.5e-83|68.5|146/146|Phage_30_3| RP:SCP:NREP 1 RP:SCP:REP 6->149|2b3wA1|2e-10|19.5|128/160|d.336.1.1| HM:SCP:REP 5->150|2b3wA1|4.2e-22|29.9|137/0|d.336.1.1|1/1|YbiA-like| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------------------------------------------------------------------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------1---------------111-1--------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 72.5 SQ:SECSTR ###EccTTcGGGTTcTTccccEEETTEEEccHHHHHHHHHcccHHHHHHHHHc#ccHHHHHHHHccccccccTTHHHHHHHHHHHHH#######HHHHHccHHHHHHHHHTTTEEEEEc############################## DISOP:02AL 1-1,148-150| PSIPRED cccccccccccHHHHccccccEEEEEEEEccHHHHHHHcccccHHHHHHHHHHHccHHHccccHHHHHHccccEEccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccccccccccHHHHHHHHHHHHHHHHcc //