[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 30.6
DDBJ      :30.6         hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:79 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   26->36 PF08776 * VASP_tetra 0.00041 54.5 11/40  
:BLT:SWISS 33->59 Y12K_BPT4 3e-04 69.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81487.1 GT:GENE 30.6 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(110315..110554) GB:FROM 110315 GB:TO 110554 GB:DIRECTION - GB:GENE 30.6 GB:PRODUCT hypothetical protein GB:NOTE similar to T4 accession NP_049820.1; gp30.6 GB:PROTEIN_ID AAQ81487.1 GB:DB_XREF GI:34732950 GB:GENE:GENE 30.6 LENGTH 79 SQ:AASEQ MKFTTTYFNFKTNRPDHIISGAMVPKTKEEIIEGIKAYVDSICPLEDRTDENGNDTLKIEEGARFPFMMRPQQISMRYS GT:EXON 1|1-79:0| BL:SWS:NREP 1 BL:SWS:REP 33->59|Y12K_BPT4|3e-04|69.2|26/95| SEG 2->13|kftttyfnfktn| HM:PFM:NREP 1 HM:PFM:REP 26->36|PF08776|0.00041|54.5|11/40|VASP_tetra| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,75-80| PSIPRED ccEEEEEEEEcccccccEEEcccccccHHHHHHHHHHHHHHccccccccccccccEEEEcccccccEEEcHHHEEEEcc //