[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 30.9
DDBJ      :30.9         hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:63 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->51 PF09159 * Ydc2-catalyt 0.00082 25.6 43/259  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81511.1 GT:GENE 30.9 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(131375..131566) GB:FROM 131375 GB:TO 131566 GB:DIRECTION - GB:GENE 30.9 GB:PRODUCT hypothetical protein GB:NOTE similar to T4 accession NP_049823.1; T4 gene synonym: 31.-2; gp30.9 GB:PROTEIN_ID AAQ81511.1 GB:DB_XREF GI:34732974 GB:GENE:GENE 30.9 LENGTH 63 SQ:AASEQ MAKQMKAVEKKVEAPKTGRTGYKRSKNARIDQVGNKLVARVNRQVAHINMFGQPKHEGRKRQK GT:EXON 1|1-63:0| HM:PFM:NREP 1 HM:PFM:REP 9->51|PF09159|0.00082|25.6|43/259|Ydc2-catalyt| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-24,53-64| PSIPRED cHHHHHHHHHHHHccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcc //